StarFunc result for job id P54707

User Input

>input (1039 residues)
MHQKTPEIYSVELSGTKDIVKTDKGDGKEKYRGLKNNCLELKKKNHKEEFQKELHLDDHK
LSNRELEEKYGTDIIMGLSSTRAAELLARDGPNSLTPPKQTPEIVKFLKQMVGGFSILLW
VGAFLCWIAYGIQYSSDKSASLNNVYLGCVLGLVVILTGIFAYYQEAKSTNIMSSFNKMI
PQQALVIRDSEKKTIPSEQLVVGDIVEVKGGDQIPADIRVLSSQGCRVDNSSLTGESEPQ
PRSSEFTHENPLETKNICFYSTTCLEGTVTGMVINTGDRTIIGHIASLASGVGNEKTPIA
IEIEHFVHIVAGVAVSIGILFFIIAVSLKYQVLDSIIFLIGIIVANVPEGLLATVTVTLS
LTAKRMAKKNCLVKNLEAVETLGSTSIICSDKTGTLTQNRMTVAHLWFDNQIFVADTSED
HSNQVFDQSSRTWASLSKIITLCNRAEFKPGQENVPIMKKAVIGDASETALLKFSEVILG
DVMEIRKRNRKVAEIPFNSTNKFQLSIHEMDDPHGKRFLMVMKGAPERILEKCSTIMING
EEHPLDKSTAKTFHTAYMELGGLGERVLGFCHLYLPADEFPETYSFDIDAMNFPTSNLCF
VGLLSMIDPPRSTVPDAVTKCRSAGIKVIMVTGDHPITAKAIAKSVGIISANSETVEDIA
HRLNIAVEQVNKRDAKAAVVTGMELKDMSSEQLDEILANYQEIVFARTSPQQKLIIVEGC
QRQDAVVAVTGDGVNDSPALKKADIGIAMGIAGSDAAKNAADMVLLDDNFASIVTGVEEG
RLIFDNLKKTIAYSLTKNIAELCPFLIYIIVGLPLPIGTITILFIDLGTDIIPSIALAYE
KAESDIMNRKPRHKNKDRLVNQPLAVYSYLHIGLMQALGAFLVYFTVYAQEGFLPRTLIN
LRVEWEKDYVNDLKDSYGQEWTRYQREYLEWTGYTAFFVGILVQQIADLIIRKTRRNSIF
QQGLFRNKVIWVGITSQIIIGLILSYGLGSVTALSFTMLRAQYWFVAVPHAILIWVYDEV
RKLFIRLYPGSWWDKNMYY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7x20A	0.924	0.973	0.000	986	0.833	0.878	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
2	PDB:8d3xA	0.930	0.977	0.000	989	0.623	0.654	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
3	AFDB:A2VDL6	0.959	0.977	0.000	1020	0.632	0.644	A2VDL6.pdb.gz	AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus OX=9913 GN=ATP1A2 PE=1 SV=1
4	AFDB:A8QI34	0.942	0.970	0.000	1009	0.532	0.548	A8QI34.pdb.gz	A8QI34_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=JYalpha PE=3 SV=2
5	AFDB:B0S5Q5	0.950	0.970	0.000	1017	0.627	0.640	B0S5Q5.pdb.gz
6	AFDB:B8JKS9	0.957	0.972	0.000	1023	0.609	0.619	B8JKS9.pdb.gz
7	AFDB:C0H8U1	0.954	0.964	0.000	1028	0.617	0.624	C0H8U1.pdb.gz	C0H8U1_SALSA Sodium/potassium-transporting ATPase subunit alpha OS=Salmo salar OX=8030 GN=AT1A1 PE=2 SV=1
8	AFDB:E1B8N5	0.945	0.954	0.000	1030	0.624	0.629	E1B8N5.pdb.gz	E1B8N5_BOVIN Sodium/potassium-transporting ATPase subunit alpha OS=Bos taurus OX=9913 GN=ATP1A4 PE=3 SV=2
9	AFDB:P13607	0.943	0.941	0.000	1041	0.620	0.619	P13607.pdb.gz	ATNA_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=Atpalpha PE=1 SV=3
10	AFDB:P20648	0.958	0.962	0.000	1035	0.638	0.641	P20648.pdb.gz	ATP4A_HUMAN Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens OX=9606 GN=ATP4A PE=1 SV=5
11	AFDB:P54707	1.000	1.000	0.000	1039	1.000	1.000	P54707.pdb.gz	AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens OX=9606 GN=ATP12A PE=1 SV=3
12	AFDB:P54708	0.967	0.970	0.000	1036	0.860	0.863	P54708.pdb.gz	AT12A_RAT Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus OX=10116 GN=Atp12a PE=1 SV=1
13	PDB:3ixzA	0.907	0.943	3.162E-99	998	0.621	0.646	3ixzA.pdb.gz
14	PDB:3b8eA	0.911	0.948	4.298E-99	998	0.624	0.649	3b8eA.pdb.gz	Crystal structure of the sodium-potassium pump.
15	PDB:7e7sA	0.587	0.596	1.511E-57	1020	0.261	0.266	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
16	PDB:5zmwA	0.567	0.585	3.471E-55	1000	0.263	0.273	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
17	PDB:6a69A	0.539	0.599	5.802E-41	911	0.226	0.258	6a69A.pdb.gz
18	PDB:7vpkA	0.667	0.658	3.890E-35	1055	0.171	0.169	7vpkA.pdb.gz	Cryo-EM reveals mechanistic insights into lipid-facilitated polyamine export by human ATP13A2.
19	PDB:7vh5A	0.482	0.603	5.525E-35	804	0.194	0.251	7vh5A.pdb.gz
20	PDB:6rohA	0.574	0.542	1.970E-34	1112	0.196	0.183	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A060D574	1199	875	0.557	0.662	A0A060D574_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=NAKa1c PE=2 SV=1
2	A0A060D9G1	1190	876	0.545	0.646	A0A060D9G1_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=NAKa1a PE=2 SV=1
3	A0A060XA63	702	517	0.320	0.642	A0A060XA63_ONCMY Sodium/potassium-transporting ATPase subunit alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00000245001 PE=3 SV=1
4	A0A060YJC3	1337	992	0.621	0.650	A0A060YJC3_ONCMY Sodium/potassium-transporting ATPase subunit alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00025817001 PE=3 SV=1
5	A0A060YK73	703	534	0.323	0.629	A0A060YK73_ONCMY Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00025818001 PE=3 SV=1
6	A0A075Q735	829	639	0.391	0.635	A0A075Q735_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=ATP1A1 PE=2 SV=1
7	A0A075QE41	852	661	0.404	0.635	A0A075QE41_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=ATP1A1 PE=2 SV=1
8	A2VDL6	1374	1020	0.628	0.639	AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus OX=9913 GN=ATP1A2 PE=1 SV=1
9	A8QI34	1123	1009	0.527	0.543	A8QI34_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=JYalpha PE=3 SV=2
10	C0H8U1	1308	1028	0.612	0.619	C0H8U1_SALSA Sodium/potassium-transporting ATPase subunit alpha OS=Salmo salar OX=8030 GN=AT1A1 PE=2 SV=1
11	C0PUF8	721	524	0.328	0.651	C0PUF8_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=AT1A1 PE=2 SV=1
12	E1B8N5	1326	1030	0.617	0.622	E1B8N5_BOVIN Sodium/potassium-transporting ATPase subunit alpha OS=Bos taurus OX=9913 GN=ATP1A4 PE=3 SV=2
13	F1MR06	1310	988	0.608	0.640	F1MR06_BOVIN Sodium/potassium-transporting ATPase subunit alpha OS=Bos taurus OX=9913 GN=ATP1A3 PE=3 SV=3
14	P05023	1379	1023	0.628	0.638	AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1
15	P05024	1381	1021	0.638	0.649	AT1A1_PIG Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa OX=9823 GN=ATP1A1 PE=1 SV=1
16	P06685	1367	1023	0.624	0.633	AT1A1_RAT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Atp1a1 PE=1 SV=1
17	P06686	1371	1020	0.628	0.640	AT1A2_RAT Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Atp1a2 PE=1 SV=1
18	P06687	1376	1013	0.623	0.639	AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Atp1a3 PE=1 SV=2
19	P09572	1357	1021	0.635	0.646	AT1A1_CHICK Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus OX=9031 GN=ATP1A1 PE=2 SV=1
20	P09626	1378	1033	0.638	0.642	ATP4A_RAT Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus OX=10116 GN=Atp4a PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	1.3e-21	87.7	Cation transport ATPase (P-type)
2	PF00689 Cation_ATPase_C	8e-36	135.0	Cation transporting ATPase, C-terminus
3	PF00690 Cation_ATPase_N	3.2e-11	54.1	Cation transporter/ATPase, N-terminus
4	PF00122 E1-E2_ATPase	3.6e-43	158.7	E1-E2 ATPase
5	PF00487 FA_desaturase	8e+02	11.2	Fatty acid desaturase
6	PF12710 HAD	3.7e+02	13.0	haloacid dehalogenase-like hydrolase
7	PF00702 Hydrolase	1.6e-15	69.5	haloacid dehalogenase-like hydrolase
8	PF08282 Hydrolase_3	0.0015	29.9	haloacid dehalogenase-like hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000218548

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362329	0.966	Pyrophosphatase 1
2	9606.ENSP00000334216	0.960	Potassium-transporting ATPase subunit beta
3	9606.ENSP00000356790	0.926	Sodium/potassium-transporting ATPase subunit beta-1
4	9606.ENSP00000343885	0.905	Inorganic pyrophosphatase 2, mitochondrial
5	9606.ENSP00000357835	0.900	Phospholysine phosphohistidine inorganic pyrophosphate phosphatase
6	9606.ENSP00000360372	0.872	Cytochrome P450 2C19
7	9606.ENSP00000366506	0.870	Histamine H2 receptor
8	9606.ENSP00000263980	0.862	Sodium/hydrogen exchanger 1
9	9606.ENSP00000286371	0.859	Sodium/potassium-transporting ATPase subunit beta-3
10	9606.ENSP00000331358	0.859	Gastrin
11	9606.ENSP00000250111	0.838	Sodium/potassium-transporting ATPase subunit beta-2
12	9606.ENSP00000234396	0.835	V-type proton ATPase subunit B, kidney isoform
13	9606.ENSP00000265686	0.816	V-type proton ATPase 116 kDa subunit a isoform 3
14	9606.ENSP00000262623	0.806	Potassium-transporting ATPase alpha chain 1
15	9606.ENSP00000292079	0.803	Sodium/potassium-transporting ATPase subunit gamma
16	9606.ENSP00000440045	0.786	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
17	9606.ENSP00000264649	0.785	V-type proton ATPase 116 kDa subunit a isoform 1
18	9606.ENSP00000308122	0.785	V-type proton ATPase 116 kDa subunit a isoform 4
19	9606.ENSP00000350132	0.763	Cardiac phospholamban
20	9606.ENSP00000481244	0.762	Phospholemman

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005391	0.998	P-type sodium:potassium-exchanging transporter activity
GO:0005488	0.996	binding
GO:0005515	0.993	protein binding
GO:0009678	0.304	pyrophosphate hydrolysis-driven proton transmembrane transporter activity
GO:0043167	0.301	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.968	cellular process
GO:0065007	0.895	biological regulation
GO:0051179	0.796	localization
GO:0050896	0.768	response to stimulus
GO:0006810	0.596	transport
GO:0030317	0.547	flagellated sperm motility
GO:0032501	0.490	multicellular organismal process
GO:0050789	0.485	regulation of biological process
GO:0042221	0.449	response to chemical
GO:0050794	0.401	regulation of cellular process
GO:0006811	0.375	monoatomic ion transport
GO:0048878	0.321	chemical homeostasis
GO:0051716	0.307	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.925	protein-containing complex
GO:0043227	0.841	membrane-bounded organelle
GO:0005622	0.821	intracellular anatomical structure
GO:0005737	0.804	cytoplasm
GO:0043231	0.783	intracellular membrane-bounded organelle
GO:0098590	0.601	plasma membrane region
GO:0031982	0.595	vesicle
GO:0098796	0.471	membrane protein complex
GO:0012505	0.320	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18353	0.998	ATP + H2O + K(+)(out) + Na(+)(in) = ADP + H(+) + K(+)(in) + Na(+)(out) + phosphate
EC:7.2.2.13	0.998	Na(+)/K(+)-exchanging ATPase.
RHEA:13973	0.304	diphosphate + H(+)(in) + H2O = 2 H(+)(out) + 2 phosphate
EC:7.1.3.1	0.304	H(+)-exporting diphosphatase.

[back to server]