StarFunc result for job id P54710

User Input

>input (66 residues)
MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQ
INEDEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P54710	1.000	1.000	2.934E-9	66	1.000	1.000	P54710.pdb.gz	ATNG_HUMAN Sodium/potassium-transporting ATPase subunit gamma OS=Homo sapiens OX=9606 GN=FXYD2 PE=1 SV=3
2	AFDB:Q04646	0.687	0.651	1.973E-5	70	0.712	0.671	Q04646.pdb.gz	ATNG_MOUSE Sodium/potassium-transporting ATPase subunit gamma OS=Mus musculus OX=10090 GN=Fxyd2 PE=1 SV=2
3	AFDB:Q63113	0.498	0.386	1.327E-1	87	0.303	0.230	Q63113.pdb.gz	FXYD4_RAT FXYD domain-containing ion transport regulator 4 OS=Rattus norvegicus OX=10116 GN=Fxyd4 PE=1 SV=1
4	AFDB:P58549	0.591	0.494	3.256E-1	80	0.303	0.250	P58549.pdb.gz	FXYD7_HUMAN FXYD domain-containing ion transport regulator 7 OS=Homo sapiens OX=9606 GN=FXYD7 PE=1 SV=1
5	AFDB:Q9C9T2	0.414	0.084	4.434	451	0.167	0.024	Q9C9T2.pdb.gz	SARD1_ARATH Protein SAR DEFICIENT 1 OS=Arabidopsis thaliana OX=3702 GN=SARD1 PE=1 SV=1
6	AFDB:Q9W404	0.469	0.086	5.221	406	0.136	0.022	Q9W404.pdb.gz	Q9W404_DROME GH10714p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3842 PE=2 SV=1
7	AFDB:Q9M066	0.300	0.069	6.669	524	0.167	0.021	Q9M066.pdb.gz	C90C1_ARATH 3-epi-6-deoxocathasterone 23-monooxygenase CYP90C1 OS=Arabidopsis thaliana OX=3702 GN=CYP90C1 PE=1 SV=3
8	AFDB:Q582J2	0.337	0.072	7.851	464	0.167	0.024	Q582J2.pdb.gz	Q582J2_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.210 PE=3 SV=1
9	AFDB:Q5ZEF1	0.234	0.134	7.851	127	0.167	0.087	Q5ZEF1.pdb.gz	NRR_ORYSJ Protein NEGATIVE REGULATOR OF RESISTANCE OS=Oryza sativa subsp. japonica OX=39947 GN=NRR PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P54710	4.98e-43	134	66	1.000	1.000	ATNG_HUMAN Sodium/potassium-transporting ATPase subunit gamma OS=Homo sapiens OX=9606 GN=FXYD2 PE=1 SV=3
2	Q58K79	9.65e-33	108	65	0.818	0.831	Q58K79_PIG FXYD domain-containing ion transport regulator OS=Sus scrofa OX=9823 GN=FXYD2 PE=1 SV=1
3	Q04679	1.78e-31	105	66	0.758	0.758	ATNG_RAT Sodium/potassium-transporting ATPase subunit gamma OS=Rattus norvegicus OX=10116 GN=Fxyd2 PE=2 SV=2
4	Q04646	1.19e-29	101	70	0.712	0.671	ATNG_MOUSE Sodium/potassium-transporting ATPase subunit gamma OS=Mus musculus OX=10090 GN=Fxyd2 PE=1 SV=2
5	O00168	5.27e-15	65.1	92	0.470	0.337	PLM_HUMAN Phospholemman OS=Homo sapiens OX=9606 GN=FXYD1 PE=1 SV=2
6	Q3SZX0	6.56e-15	64.7	92	0.470	0.337	PLM_BOVIN Phospholemman OS=Bos taurus OX=9913 GN=FXYD1 PE=1 SV=1
7	Q9D164	9.26e-15	64.3	94	0.409	0.287	FXYD6_MOUSE FXYD domain-containing ion transport regulator 6 OS=Mus musculus OX=10090 GN=Fxyd6 PE=1 SV=2
8	Q9H0Q3	9.29e-15	64.3	95	0.394	0.274	FXYD6_HUMAN FXYD domain-containing ion transport regulator 6 OS=Homo sapiens OX=9606 GN=FXYD6 PE=1 SV=1
9	P56513	3.68e-14	62.8	92	0.455	0.326	PLM_CANLF Phospholemman OS=Canis lupus familiaris OX=9615 GN=FXYD1 PE=1 SV=1
10	I3LMB3	2.71e-13	60.5	87	0.409	0.310	PLM_PIG Phospholemman OS=Sus scrofa OX=9823 GN=FXYD1 PE=1 SV=2
11	P58549	2.62e-09	50.1	80	0.273	0.225	FXYD7_HUMAN FXYD domain-containing ion transport regulator 7 OS=Homo sapiens OX=9606 GN=FXYD7 PE=1 SV=1
12	Q61835	3.62e-08	47.4	88	0.364	0.273	FXYD3_MOUSE FXYD domain-containing ion transport regulator 3 OS=Mus musculus OX=10090 GN=Fxyd3 PE=1 SV=1
13	Q63113	1.15e-07	46.2	87	0.333	0.253	FXYD4_RAT FXYD domain-containing ion transport regulator 4 OS=Rattus norvegicus OX=10116 GN=Fxyd4 PE=1 SV=1
14	Q9Z239	2.10e-07	45.4	92	0.470	0.337	PLM_MOUSE Phospholemman OS=Mus musculus OX=10090 GN=Fxyd1 PE=1 SV=1
15	O08589	3.45e-07	45.1	92	0.470	0.337	PLM_RAT Phospholemman OS=Rattus norvegicus OX=10116 GN=Fxyd1 PE=1 SV=2
16	Q14802	6.72e-07	44.3	87	0.288	0.218	FXYD3_HUMAN FXYD domain-containing ion transport regulator 3 OS=Homo sapiens OX=9606 GN=FXYD3 PE=1 SV=1
17	P59649	2.31e-06	42.7	80	0.242	0.200	FXYD7_RAT FXYD domain-containing ion transport regulator 7 OS=Rattus norvegicus OX=10116 GN=Fxyd7 PE=1 SV=1
18	P59646	2.35e-06	42.7	89	0.258	0.191	FXYD4_HUMAN FXYD domain-containing ion transport regulator 4 OS=Homo sapiens OX=9606 GN=FXYD4 PE=3 SV=2
19	Q96DB9	2.82e-05	41.2	178	0.258	0.096	FXYD5_HUMAN FXYD domain-containing ion transport regulator 5 OS=Homo sapiens OX=9606 GN=FXYD5 PE=1 SV=2
20	B0S4R4	1.63e-04	37.7	70	0.303	0.286	B0S4R4_SALSA FXYD domain-containing ion transport regulator OS=Salmo salar OX=8030 GN=fxyd11b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02038 ATP1G1_PLM_MAT8	7.2e-22	87.9	ATP1G1/PLM/MAT8 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000292079

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000445306	0.997	Sodium/potassium-transporting ATPase subunit alpha-1
2	9606.ENSP00000356790	0.981	Sodium/potassium-transporting ATPase subunit beta-1
3	9606.ENSP00000357060	0.972	Sodium/potassium-transporting ATPase subunit alpha-4
4	9606.ENSP00000444688	0.971	Sodium/potassium-transporting ATPase subunit alpha-3
5	9606.ENSP00000354490	0.965	Sodium/potassium-transporting ATPase subunit alpha-2
6	9606.ENSP00000218008	0.936	Protein ATP1B4
7	9606.ENSP00000286371	0.925	Sodium/potassium-transporting ATPase subunit beta-3
8	9606.ENSP00000250111	0.922	Sodium/potassium-transporting ATPase subunit beta-2
9	9606.ENSP00000387699	0.903	Cyclic AMP-responsive element-binding protein 1
10	9606.ENSP00000303174	0.902	UDP-glucuronosyltransferase 1-6
11	9606.ENSP00000216117	0.900	Heme oxygenase 1
12	9606.ENSP00000235835	0.900	Aflatoxin B1 aldehyde reductase member 2
13	9606.ENSP00000306245	0.900	Proto-oncogene c-Fos
14	9606.ENSP00000360266	0.900	Transcription factor AP-1
15	9606.ENSP00000380252	0.900	Nuclear factor erythroid 2-related factor 2
16	9606.ENSP00000399805	0.900	Quinone oxidoreductase
17	9606.ENSP00000419970	0.900	NADPH--cytochrome P450 reductase
18	9606.ENSP00000420168	0.900	Glutathione S-transferase A2
19	9606.ENSP00000477572	0.900	Heme oxygenase 2
20	9606.ENSP00000483791	0.842	FXYD domain containing ion transport regulator 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0043269	0.992	regulation of monoatomic ion transport
GO:0010959	0.976	regulation of metal ion transport
GO:1904062	0.976	regulation of monoatomic cation transmembrane transport
GO:1902305	0.968	regulation of sodium ion transmembrane transport
GO:0009987	0.966	cellular process
GO:0032412	0.962	regulation of monoatomic ion transmembrane transporter activity
GO:0098655	0.949	monoatomic cation transmembrane transport
GO:2000649	0.949	regulation of sodium ion transmembrane transporter activity
GO:0098662	0.916	inorganic cation transmembrane transport
GO:0043266	0.916	regulation of potassium ion transport
GO:0030001	0.906	metal ion transport
GO:0006813	0.890	potassium ion transport
GO:0034764	0.878	positive regulation of transmembrane transport
GO:1901016	0.827	regulation of potassium ion transmembrane transporter activity
GO:0043270	0.819	positive regulation of monoatomic ion transport
GO:0043462	0.761	regulation of ATP-dependent activity
GO:0098739	0.754	import across plasma membrane
GO:0034767	0.712	positive regulation of monoatomic ion transmembrane transport
GO:0010765	0.709	positive regulation of sodium ion transport
GO:0048878	0.686	chemical homeostasis
GO:1903406	0.660	regulation of P-type sodium:potassium-exchanging transporter activity
GO:0006814	0.657	sodium ion transport
GO:0098657	0.650	import into cell
GO:0099587	0.622	inorganic ion import across plasma membrane
GO:1904064	0.590	positive regulation of cation transmembrane transport
GO:0071805	0.579	potassium ion transmembrane transport
GO:0032411	0.575	positive regulation of transporter activity
GO:0032414	0.569	positive regulation of ion transmembrane transporter activity
GO:1902307	0.505	positive regulation of sodium ion transmembrane transport
GO:0098771	0.484	inorganic ion homeostasis
GO:1901018	0.470	positive regulation of potassium ion transmembrane transporter activity
GO:0055080	0.467	monoatomic cation homeostasis
GO:0019725	0.357	cellular homeostasis
GO:0050896	0.335	response to stimulus
GO:0035725	0.331	sodium ion transmembrane transport
GO:0098659	0.328	inorganic cation import across plasma membrane
GO:0030003	0.320	intracellular monoatomic cation homeostasis
GO:0055075	0.307	potassium ion homeostasis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0098533	0.998	ATPase dependent transmembrane transport complex
GO:0043227	0.991	membrane-bounded organelle
GO:0098797	0.991	plasma membrane protein complex
GO:0090533	0.982	cation-transporting ATPase complex
GO:0005576	0.939	extracellular region
GO:0005890	0.937	sodium:potassium-exchanging ATPase complex
GO:1903561	0.898	extracellular vesicle
GO:0005615	0.862	extracellular space
GO:0070062	0.788	extracellular exosome
GO:0005622	0.727	intracellular anatomical structure
GO:0043231	0.640	intracellular membrane-bounded organelle
GO:0005737	0.614	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]