StarFunc result for job id P54727

User Input

>input (409 residues)
MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALK
EYKIDEKNFVVVMVTKPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPT
STPASITPASATASSEPAPASAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDA
TSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVD
PPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP
ALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYI
QVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P54728	0.421	0.416	7.495E-53	416	0.910	0.894	P54728.pdb.gz	RD23B_MOUSE UV excision repair protein RAD23 homolog B OS=Mus musculus OX=10090 GN=Rad23b PE=1 SV=2
2	AFDB:A0A024R7G8	0.245	0.267	5.305E-35	363	0.584	0.658	A0A024R7G8.pdb.gz
3	AFDB:F4IF85	0.232	0.240	1.124E-27	395	0.384	0.397	F4IF85.pdb.gz	F4IF85_ARATH Ubiquitin receptor RAD23 OS=Arabidopsis thaliana OX=3702 GN=RAD23B PE=1 SV=1
4	AFDB:Q84L33	0.290	0.308	1.187E-27	371	0.381	0.420	Q84L33.pdb.gz	RD23B_ARATH Ubiquitin receptor RAD23b OS=Arabidopsis thaliana OX=3702 GN=RAD23B PE=1 SV=3
5	AFDB:Q84L31	0.345	0.338	6.522E-27	419	0.389	0.379	Q84L31.pdb.gz	RD23C_ARATH Ubiquitin receptor RAD23c OS=Arabidopsis thaliana OX=3702 GN=RAD23C PE=1 SV=2
6	AFDB:Q84L32	0.236	0.253	7.731E-26	368	0.374	0.416	Q84L32.pdb.gz	RD23A_ARATH Probable ubiquitin receptor RAD23a OS=Arabidopsis thaliana OX=3702 GN=RAD23A PE=2 SV=2
7	PDB:1oqyA	0.190	0.213	1.505E-22	363	0.582	0.656	1oqyA.pdb.gz
8	AFDB:P32628	0.274	0.279	2.254E-20	398	0.315	0.324	P32628.pdb.gz	RAD23_YEAST UV excision repair protein RAD23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD23 PE=1 SV=1
9	PDB:1qzeA	0.177	0.334	7.604E-17	214	0.428	0.818	1qzeA.pdb.gz
10	AFDB:Q587D1	0.272	0.303	9.044E-17	356	0.249	0.287	Q587D1.pdb.gz	Q587D1_TRYB2 UV excision repair RAD23 protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.360 PE=4 SV=1
11	AFDB:Q9NRR5	0.186	0.132	1.717E-9	601	0.252	0.171	Q9NRR5.pdb.gz	UBQL4_HUMAN Ubiquilin-4 OS=Homo sapiens OX=9606 GN=UBQLN4 PE=1 SV=2
12	AFDB:D4AA63	0.196	0.137	1.936E-7	638	0.279	0.179	D4AA63.pdb.gz	D4AA63_RAT Ubiquilin 2 OS=Rattus norvegicus OX=10116 GN=Ubqln2 PE=4 SV=1
13	PDB:3ai5A	0.170	0.231	9.496E-6	299	0.056	0.077	3ai5A.pdb.gz
14	PDB:3dbhI	0.171	0.751	1.060E-5	86	0.061	0.291	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
15	PDB:6ef3u	0.172	0.837	1.250E-5	75	0.054	0.293	6ef3u.pdb.gz	Substrate-engaged 26Sproteasome structures reveal mechanisms for ATP-hydrolysis-driven translocation.
16	PDB:6yvaC	0.177	0.454	4.673E-5	155	0.042	0.110	6yvaC.pdb.gz
17	PDB:6mdhA	0.169	0.451	2.567E-4	149	0.032	0.087	6mdhA.pdb.gz
18	PDB:4pyuA	0.171	0.855	2.865E-4	76	0.027	0.145	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
19	PDB:7rbsB	0.176	0.442	3.378E-4	157	0.032	0.083	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
20	PDB:4x57B	0.174	0.694	4.208E-4	93	0.049	0.215	4x57B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P54727	0.0	824	409	1.000	1.000	RD23B_HUMAN UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1
2	P54728	0.0	646	416	0.907	0.892	RD23B_MOUSE UV excision repair protein RAD23 homolog B OS=Mus musculus OX=10090 GN=Rad23b PE=1 SV=2
3	Q4KMA2	0.0	633	415	0.912	0.899	RD23B_RAT UV excision repair protein RAD23 homolog B OS=Rattus norvegicus OX=10116 GN=Rad23b PE=1 SV=1
4	P54725	3.75e-136	395	363	0.584	0.658	RD23A_HUMAN UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A PE=1 SV=1
5	P54726	1.31e-134	392	363	0.592	0.667	RD23A_MOUSE UV excision repair protein RAD23 homolog A OS=Mus musculus OX=10090 GN=Rad23a PE=1 SV=2
6	Q9V3W9	7.77e-84	264	414	0.413	0.408	Q9V3W9_DROME UV excision repair protein RAD23 OS=Drosophila melanogaster OX=7227 GN=Rad23 PE=1 SV=1
7	Q9XZE0	4.44e-83	262	414	0.411	0.406	Q9XZE0_DROME UV excision repair protein RAD23 OS=Drosophila melanogaster OX=7227 GN=Rad23 PE=3 SV=1
8	Q84L33	1.05e-80	254	371	0.391	0.431	RD23B_ARATH Ubiquitin receptor RAD23b OS=Arabidopsis thaliana OX=3702 GN=RAD23B PE=1 SV=3
9	F4IF85	2.58e-80	254	395	0.399	0.413	F4IF85_ARATH Ubiquitin receptor RAD23 OS=Arabidopsis thaliana OX=3702 GN=RAD23B PE=1 SV=1
10	Q84L31	2.96e-76	244	419	0.401	0.391	RD23C_ARATH Ubiquitin receptor RAD23c OS=Arabidopsis thaliana OX=3702 GN=RAD23C PE=1 SV=2
11	Q84L32	3.30e-72	232	368	0.374	0.416	RD23A_ARATH Probable ubiquitin receptor RAD23a OS=Arabidopsis thaliana OX=3702 GN=RAD23A PE=2 SV=2
12	O74803	3.35e-69	224	368	0.403	0.448	RHP23_SCHPO UV excision repair protein rhp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp23 PE=1 SV=1
13	Q84L30	5.74e-65	214	378	0.355	0.384	RD23D_ARATH Ubiquitin receptor RAD23d OS=Arabidopsis thaliana OX=3702 GN=RAD23D PE=1 SV=2
14	Q8IMB7	8.31e-59	197	343	0.291	0.347	Q8IMB7_DROME UV excision repair protein RAD23 OS=Drosophila melanogaster OX=7227 GN=Rad23 PE=1 SV=1
15	K7EQ16	1.71e-43	150	150	0.230	0.627	K7EQ16_HUMAN UV excision repair protein RAD23 (Fragment) OS=Homo sapiens OX=9606 GN=RAD23A PE=1 SV=1
16	A0A1D8PGE3	9.07e-42	154	416	0.333	0.327	A0A1D8PGE3_CANAL UV excision repair protein RAD23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD23 PE=3 SV=1
17	P32628	8.92e-41	150	398	0.333	0.342	RAD23_YEAST UV excision repair protein RAD23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD23 PE=1 SV=1
18	Q54LV1	2.47e-30	121	342	0.198	0.237	RAD23_DICDI UV excision repair protein RAD23 homolog OS=Dictyostelium discoideum OX=44689 GN=rcbA PE=1 SV=1
19	Q587D1	1.78e-20	94.0	356	0.267	0.306	Q587D1_TRYB2 UV excision repair RAD23 protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.360 PE=4 SV=1
20	F4KCN6	9.51e-10	59.7	171	0.086	0.205	F4KCN6_ARATH Ubiquitin receptor RAD23 OS=Arabidopsis thaliana OX=3702 GN=At5g16090 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20147 Crinkler	0.78	21.8	Crinkler effector protein N-terminal domain
2	PF10302 Dsc3_N	45	16.0	DSC E3 ubiquitin ligase complex subunit 3, ubiquitin-like domain
3	PF07223 DUF1421	6.4e+02	11.6	UBA-like domain (DUF1421)
4	PF06972 GIP1_N	3.5e+02	12.7	GBF-interacting protein 1 N-terminal
5	PF11976 Rad60-SLD	0.00078	30.5	Ubiquitin-2 like Rad60 SUMO-like
6	PF13881 Rad60-SLD_2	0.042	25.3	Ubiquitin-2 like Rad60 SUMO-like
7	PF00627 UBA	1.3e-22	90.5	UBA/TS-N domain
8	PF08587 UBA_2	3.4e+02	12.7	Ubiquitin associated domain (UBA)
9	PF09288 UBA_3	1.7	19.8	Fungal ubiquitin-associated domain
10	PF00240 ubiquitin	7.6e-18	75.4	Ubiquitin family
11	PF14560 Ubiquitin_2	4.4e+02	12.8	Ubiquitin-like domain
12	PF18036 Ubiquitin_4	2.9e+02	12.9	Ubiquitin-like domain
13	PF09280 XPC-binding	7.6e-22	88.1	XPC-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350708

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000285021	0.999	DNA repair protein complementing XP-C cells
2	9606.ENSP00000357879	0.999	26S proteasome non-ATPase regulatory subunit 4
3	9606.ENSP00000359300	0.999	Centrin-2
4	9606.ENSP00000280700	0.998	Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase
5	9606.ENSP00000364270	0.998	DNA repair protein complementing XP-A cells
6	9606.ENSP00000013807	0.996	DNA excision repair protein ERCC-1
7	9606.ENSP00000310520	0.984	DNA repair endonuclease XPF
8	9606.ENSP00000478320	0.984	Ataxin-3
9	9606.ENSP00000441543	0.982	Polyubiquitin-C
10	9606.ENSP00000347978	0.978	DNA repair protein complementing XP-G cells
11	9606.ENSP00000261303	0.976	26S proteasome regulatory subunit 4
12	9606.ENSP00000310129	0.972	26S proteasome non-ATPase regulatory subunit 2
13	9606.ENSP00000391211	0.972	26S proteasome regulatory subunit 7
14	9606.ENSP00000343001	0.970	Ubiquitin conjugation factor E4 B
15	9606.ENSP00000265038	0.967	DNA excision repair protein ERCC-8
16	9606.ENSP00000316176	0.959	Ubiquitin-conjugating enzyme E2 N
17	9606.ENSP00000234420	0.958	DNA mismatch repair protein Msh6
18	9606.ENSP00000301764	0.958	DNA damage-binding protein 1
19	9606.ENSP00000484288	0.954	DNA ligase 4
20	9606.ENSP00000304697	0.953	Polyubiquitin-B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	1.000	DNA binding
GO:0140030	0.983	modification-dependent protein binding
GO:0140299	0.972	small molecule sensor activity
GO:0031593	0.909	polyubiquitin modification-dependent protein binding
GO:0008134	0.903	transcription factor binding
GO:0043565	0.868	sequence-specific DNA binding
GO:0003697	0.850	single-stranded DNA binding
GO:0140297	0.813	DNA-binding transcription factor binding
GO:0061629	0.798	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003690	0.570	double-stranded DNA binding
GO:0044877	0.537	protein-containing complex binding
GO:0001067	0.386	transcription regulatory region nucleic acid binding
GO:0000976	0.378	transcription cis-regulatory region binding
GO:0000978	0.346	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051716	0.985	cellular response to stimulus
GO:0008152	0.982	metabolic process
GO:0006974	0.977	cellular response to DNA damage stimulus
GO:0071704	0.973	organic substance metabolic process
GO:0044237	0.966	cellular metabolic process
GO:0044238	0.941	primary metabolic process
GO:0006807	0.927	nitrogen compound metabolic process
GO:0043170	0.906	macromolecule metabolic process
GO:0050789	0.891	regulation of biological process
GO:0034641	0.836	cellular nitrogen compound metabolic process
GO:0044260	0.832	cellular macromolecule metabolic process
GO:0006725	0.798	cellular aromatic compound metabolic process
GO:1901360	0.792	organic cyclic compound metabolic process
GO:0050794	0.756	regulation of cellular process
GO:0046483	0.741	heterocycle metabolic process
GO:0006139	0.688	nucleobase-containing compound metabolic process
GO:0032502	0.670	developmental process
GO:0032501	0.668	multicellular organismal process
GO:0090304	0.649	nucleic acid metabolic process
GO:0006259	0.609	DNA metabolic process
GO:0019222	0.535	regulation of metabolic process
GO:0006281	0.518	DNA repair
GO:0080090	0.478	regulation of primary metabolic process
GO:0051171	0.475	regulation of nitrogen compound metabolic process
GO:0060255	0.471	regulation of macromolecule metabolic process
GO:1901564	0.446	organonitrogen compound metabolic process
GO:0019538	0.442	protein metabolic process
GO:0031323	0.434	regulation of cellular metabolic process
GO:0006289	0.363	nucleotide-excision repair
GO:0048518	0.350	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0032991	0.990	protein-containing complex
GO:0005654	0.987	nucleoplasm
GO:0005829	0.978	cytosol
GO:0140513	0.729	nuclear protein-containing complex
GO:0043232	0.395	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]