StarFunc result for job id P54750

User Input

>input (535 residues)
MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGILRCLVKQLERGDVNVVDLKKNIEYAA
SVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLASTFTRKMGMTKKKPEEKPKFRS
IVHAVQAGIFVERMYRKTYHMVGLAYPAAVIVTLKDVDKWSFDVFALNEASGEHSLKFMI
YELFTRYDLINRFKIPVSCLITFAEALEVGYSKYKNPYHNLIHAADVTQTVHYIMLHTGI
MHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLM
QEEEMNILINLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGIDRAKTMSL
ILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGF
IDFIVEPTFSLLTDSTEKIVIPLIEEASKAETSSYVASSSTTIVGLHIADALRRSNTKGS
MSDGSYSPDYSLAAVDLKSFKNNLVDIIQQNKERWKELAAQEARTSSQKCEFIHQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61481	0.744	0.731	1.899E-55	545	0.916	0.899	Q61481.pdb.gz	PDE1A_MOUSE Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Mus musculus OX=10090 GN=Pde1a PE=1 SV=3
2	AFDB:E7F6Z8	0.717	0.630	5.679E-48	611	0.725	0.635	E7F6Z8.pdb.gz	E7F6Z8_DANRE Phosphodiesterase OS=Danio rerio OX=7955 GN=pde1a PE=3 SV=3
3	AFDB:Q63421	0.674	0.473	1.190E-41	768	0.658	0.458	Q63421.pdb.gz	PDE1C_RAT Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C OS=Rattus norvegicus OX=10116 GN=Pde1c PE=1 SV=1
4	AFDB:Q01064	0.655	0.654	4.237E-38	536	0.566	0.565	Q01064.pdb.gz	PDE1B_HUMAN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Homo sapiens OX=9606 GN=PDE1B PE=1 SV=2
5	AFDB:O18696	0.650	0.526	1.073E-33	664	0.458	0.369	O18696.pdb.gz	PDE1_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-1 OS=Caenorhabditis elegans OX=6239 GN=pde-1 PE=1 SV=2
6	AFDB:B7YZV4	0.622	0.400	7.147E-31	834	0.424	0.272	B7YZV4.pdb.gz	PDE1_DROME Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1 OS=Drosophila melanogaster OX=7227 GN=Pde1c PE=1 SV=1
7	AFDB:B1AWC9	0.541	0.398	2.025E-22	736	0.262	0.190	B1AWC9.pdb.gz	B1AWC9_MOUSE Phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
8	AFDB:A0A140VJR0	0.534	0.357	2.082E-21	809	0.288	0.190	A0A140VJR0.pdb.gz	A0A140VJR0_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=2 SV=1
9	AFDB:O89084	0.539	0.346	2.169E-21	844	0.271	0.172	O89084.pdb.gz	PDE4A_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Mus musculus OX=10090 GN=Pde4a PE=1 SV=2
10	AFDB:Q9W4T4	0.537	0.243	2.354E-21	1209	0.250	0.111	Q9W4T4.pdb.gz	PDE4A_DROME cAMP-specific 3',5'-cyclic phosphodiesterase, isoform I OS=Drosophila melanogaster OX=7227 GN=dnc PE=1 SV=2
11	PDB:4y86B	0.499	0.805	2.743E-16	326	0.168	0.276	4y86B.pdb.gz	Structural Asymmetry of Phosphodiesterase-9A and a Unique Pocket for Selective Binding of a Potent Enantiomeric Inhibitor.
12	PDB:7jsnA	0.481	0.322	1.594E-12	820	0.176	0.115	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
13	PDB:6mzbB	0.533	0.358	4.431E-12	807	0.181	0.120	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
14	PDB:3bjcA	0.452	0.754	8.766E-11	311	0.142	0.244	3bjcA.pdb.gz	An insight into the pharmacophores of phosphodiesterase-5 inhibitors from synthetic and crystal structural studies
15	PDB:7lciR	0.120	0.151	7.190E-2	393	0.075	0.102	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
16	PDB:7uzqK	0.111	0.135	1.274E-1	380	0.082	0.116	7uzqK.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
17	PDB:5yqzR	0.106	0.103	2.554E-1	558	0.105	0.100	5yqzR.pdb.gz	Structure of the glucagon receptor in complex with a glucagon analogue.
18	PDB:7p5cA	0.087	0.108	2.887E-1	392	0.090	0.122	7p5cA.pdb.gz
19	PDB:1rqiA	0.148	0.213	3.264E-1	300	0.095	0.170	1rqiA.pdb.gz	Structural basis for bisphosphonate-mediated inhibition of isoprenoid biosynthesis
20	PDB:6bgiA	0.090	0.093	4.345E-1	510	0.086	0.090	6bgiA.pdb.gz	Cryo-EM structures of the TMEM16A calcium-activated chloride channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JZX9	871	465	0.800	0.920	A0A0G2JZX9_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=2
2	A0A0G2K2K1	944	515	0.864	0.897	A0A0G2K2K1_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=2
3	A0A2R8RXK7	808	587	0.708	0.646	A0A2R8RXK7_DANRE Phosphodiesterase OS=Danio rerio OX=7955 GN=pde1a PE=3 SV=1
4	A0A8I5Y792	918	515	0.860	0.893	A0A8I5Y792_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
5	A0A8I5Y879	941	508	0.869	0.915	A0A8I5Y879_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
6	A0A8I6A416	1001	542	0.916	0.904	A0A8I6A416_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
7	A0A8I6A5M3	942	526	0.869	0.884	A0A8I6A5M3_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
8	A0A8I6GJQ6	868	508	0.796	0.839	A0A8I6GJQ6_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
9	E7F6Z8	832	611	0.742	0.650	E7F6Z8_DANRE Phosphodiesterase OS=Danio rerio OX=7955 GN=pde1a PE=3 SV=3
10	P14100	972	530	0.890	0.898	PDE1A_BOVIN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Bos taurus OX=9913 GN=PDE1A PE=1 SV=3
11	P54750	1117	535	1.000	1.000	PDE1A_HUMAN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Homo sapiens OX=9606 GN=PDE1A PE=1 SV=2
12	Q01061	636	534	0.570	0.571	PDE1B_BOVIN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Bos taurus OX=9913 GN=PDE1B PE=1 SV=1
13	Q01064	641	536	0.572	0.571	PDE1B_HUMAN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Homo sapiens OX=9606 GN=PDE1B PE=1 SV=2
14	Q01065	638	535	0.570	0.570	PDE1B_MOUSE Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Mus musculus OX=10090 GN=Pde1b PE=1 SV=2
15	Q01066	641	535	0.570	0.570	PDE1B_RAT Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Rattus norvegicus OX=10116 GN=Pde1b PE=1 SV=1
16	Q14123	771	709	0.682	0.515	PDE1C_HUMAN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C OS=Homo sapiens OX=9606 GN=PDE1C PE=1 SV=1
17	Q61481	998	545	0.914	0.897	PDE1A_MOUSE Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Mus musculus OX=10090 GN=Pde1a PE=1 SV=3
18	Q63421	749	768	0.654	0.456	PDE1C_RAT Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C OS=Rattus norvegicus OX=10116 GN=Pde1c PE=1 SV=1
19	Q64338	778	706	0.688	0.521	PDE1C_MOUSE Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C OS=Mus musculus OX=10090 GN=Pde1c PE=1 SV=2
20	Q64395	640	535	0.570	0.570	PDE1B_CRIGR Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Cricetulus griseus OX=10029 GN=PDE1B1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00233 PDEase_I	3.6e-79	277.4	3'5'-cyclic nucleotide phosphodiesterase
2	PF08499 PDEase_I_N	2.2e-30	115.6	3'5'-cyclic nucleotide phosphodiesterase N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008975430.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003821763.1	0.962	Neurocalcin delta
2	9597.XP_003817536.1	0.948	Belongs to the calmodulin family.
3	9597.XP_008973372.1	0.918	Belongs to the lyase 1 family. Adenylosuccinate lyase subfamily
4	9597.XP_003813051.1	0.915	Adenosine kinase
5	9597.XP_003833445.1	0.914	Phosphodiesterase 1C
6	9597.XP_003807610.1	0.901	Phosphodiesterase 1B
7	9597.XP_003805815.1	0.900	Adenine phosphoribosyltransferase isoform X1
8	9597.XP_003809031.1	0.900	Deoxycytidine kinase
9	9597.XP_003823412.1	0.900	Belongs to the adenylate kinase family.
10	9597.XP_008956435.1	0.877	Calmodulin isoform X1
11	9597.XP_008974499.1	0.877	Calmodulin
12	9597.XP_003824651.1	0.809	Adenylate cyclase type 10 isoform X1
13	9597.XP_003822795.1	0.803	G protein subunit alpha transducin 3
14	9597.XP_008971923.1	0.801	G protein subunit beta 3
15	9597.XP_003830145.1	0.799	Catalyzes the formation of the signaling molecule cAMP in response to G-protein signaling
16	9597.XP_008949392.1	0.794	Adenylate cyclase type 6 isoform X1
17	9597.XP_008952065.1	0.779	Guanylate cyclase soluble subunit alpha-2
18	9597.XP_008967038.1	0.770	Catalyzes the formation of the signaling molecule cAMP in response to G-protein signaling
19	9597.XP_003822069.1	0.768	Retinal guanylyl cyclase 2
20	9597.XP_003822610.1	0.763	Guanylate cyclase soluble subunit beta-1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047555	1.000	3',5'-cyclic-GMP phosphodiesterase activity
GO:0004115	1.000	3',5'-cyclic-AMP phosphodiesterase activity
GO:0005515	0.981	protein binding
GO:0048101	0.778	calmodulin-activated 3',5'-cyclic-GMP phosphodiesterase activity
GO:0004117	0.360	calmodulin-activated dual specificity 3',5'-cyclic-GMP, 3',5'-cyclic-AMP phosphodiesterase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048660	0.996	regulation of smooth muscle cell proliferation
GO:0010941	0.995	regulation of cell death
GO:0044248	0.995	cellular catabolic process
GO:1901565	0.995	organonitrogen compound catabolic process
GO:0052652	0.995	cyclic purine nucleotide metabolic process
GO:0009150	0.995	purine ribonucleotide metabolic process
GO:0009154	0.992	purine ribonucleotide catabolic process
GO:0010660	0.986	regulation of muscle cell apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005634	0.994	nucleus
GO:0043025	0.960	neuronal cell body
GO:0005829	0.715	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:25277	1.000	3',5'-cyclic AMP + H2O = AMP + H(+)
RHEA:16957	1.000	3',5'-cyclic GMP + H2O = GMP + H(+)
EC:3.1.4.53	1.000	3',5'-cyclic-AMP phosphodiesterase.
EC:3.1.4.35	1.000	3',5'-cyclic-GMP phosphodiesterase.

[back to server]