StarFunc result for job id P54753

User Input

>input (998 residues)
MARARPPPPPSPPPGLLPLLPPLLLLPLLLLPAGCRALEETLMDTKWVTSELAWTSHPES
GWEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIP
NIPGSCKETFNLFYYEADSDVASASSPFWMENPYVKVDTIAPDESFSRLDAGRVNTKVRS
FGPLSKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGFALFPETLTGAEPTSLVIAPGT
CIPNAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGP
CLPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWS
EPRDLGGRDDLLYNVICKKCHGAGGASACSRCDDNVEFVPRQLGLTERRVHISHLLAHTR
YTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPN
GVILDYEMKYFEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAEF
ETTSERGSGAQQLQEQLPLIVGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQY
IAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREV
FVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALD
SFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLS
RFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYW
DMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAA
SLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQM
TAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4J1T8	0.391	0.347	0.000	1130	0.542	0.479	A0A0B4J1T8.pdb.gz	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	AFDB:A0A0G2JY48	0.487	0.492	0.000	986	0.686	0.695	A0A0G2JY48.pdb.gz	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	AFDB:A0A3B3IRY8	0.470	0.447	0.000	1055	0.662	0.627	A0A3B3IRY8.pdb.gz	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
4	AFDB:F1Q9D9	0.438	0.452	0.000	963	0.516	0.535	F1Q9D9.pdb.gz
5	AFDB:F1RCL1	0.418	0.428	0.000	976	0.526	0.538	F1RCL1.pdb.gz
6	AFDB:O08680	0.399	0.404	0.000	984	0.543	0.551	O08680.pdb.gz	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
7	AFDB:O15197	0.463	0.454	0.000	1021	0.461	0.451	O15197.pdb.gz	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
8	AFDB:O73875	0.436	0.440	0.000	987	0.563	0.569	O73875.pdb.gz	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
9	AFDB:O73878	0.442	0.452	0.000	976	0.542	0.554	O73878.pdb.gz	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
10	AFDB:P29322	0.500	0.496	0.000	1005	0.503	0.500	P29322.pdb.gz	EPHA8_HUMAN Ephrin type-A receptor 8 OS=Homo sapiens OX=9606 GN=EPHA8 PE=1 SV=2
11	PDB:2h8hA	0.239	0.507	2.817E-21	445	0.142	0.319	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.249	0.549	4.424E-20	441	0.101	0.229	1k9aB.pdb.gz
13	PDB:4fl2A	0.246	0.431	1.108E-19	555	0.110	0.198	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.244	0.432	1.796E-19	551	0.123	0.223	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:8dksA	0.206	0.660	4.892E-14	283	0.070	0.247	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:6s73A	0.234	0.795	3.723E-13	269	0.062	0.230	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:6lk5A	0.228	0.793	5.221E-13	265	0.062	0.234	6lk5A.pdb.gz
18	PDB:6uanB	0.210	0.745	1.246E-12	261	0.087	0.333	6uanB.pdb.gz
19	PDB:7mfdA	0.229	0.510	1.586E-12	410	0.091	0.222	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
20	PDB:4krcA	0.227	0.707	2.833E-12	297	0.061	0.205	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1T8	1058	1130	0.545	0.481	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	A0A0G2JY48	1332	965	0.652	0.675	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	A0A140VJJ0	1114	983	0.552	0.561	A0A140VJJ0_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=2 SV=1
4	A0A3B3IRY8	1386	1055	0.664	0.628	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
5	B1AKC9	1393	946	0.665	0.702	B1AKC9_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=1
6	B2B9B0	1413	986	0.686	0.695	B2B9B0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=2 SV=1
7	C9JXA2	1062	918	0.526	0.572	C9JXA2_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=1 SV=1
8	D1YSF9	684	1005	0.388	0.385	D1YSF9_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=4 SV=1
9	D3ZDH4	727	977	0.423	0.432	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
10	D3ZZK3	1102	949	0.547	0.575	D3ZZK3_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha4 PE=4 SV=2
11	F1MAJ0	1416	987	0.687	0.695	F1MAJ0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=4
12	O08644	889	1014	0.480	0.472	EPHB6_MOUSE Ephrin type-B receptor 6 OS=Mus musculus OX=10090 GN=Ephb6 PE=2 SV=4
13	O08680	1091	984	0.544	0.552	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
14	O09127	978	1004	0.491	0.488	EPHA8_MOUSE Ephrin type-A receptor 8 OS=Mus musculus OX=10090 GN=Epha8 PE=1 SV=2
15	O15197	862	1021	0.465	0.454	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
16	O73875	1104	987	0.575	0.582	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
17	O73878	1063	976	0.551	0.564	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
18	O96435	682	1019	0.397	0.389	O96435_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=2 SV=1
19	P09759	1447	984	0.692	0.702	EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegicus OX=10116 GN=Ephb1 PE=1 SV=2
20	P21709	738	976	0.427	0.436	EPHA1_HUMAN Ephrin type-A receptor 1 OS=Homo sapiens OX=9606 GN=EPHA1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	7	17.2	ABC1 atypical kinase-like domain
2	PF16492 Cadherin_C_2	60	15.7	Cadherin cytoplasmic C-terminal
3	PF14575 EphA2_TM	1.2e-24	98.2	Ephrin type-A receptor 2 transmembrane domain
4	PF01404 Ephrin_lbd	4.7e-68	240.3	Ephrin receptor ligand binding domain
5	PF07699 Ephrin_rec_like	0.0072	27.4	Tyrosine-protein kinase ephrin type A/B receptor-like
6	PF00041 fn3	1.1e-28	110.7	Fibronectin type III domain
7	PF16893 fn3_2	4.6	18.8	Fibronectin type III domain
8	PF12330 Haspin_kinase	6.9e+02	10.5	Haspin like kinase domain
9	PF09294 Interfer-bind	30	16.3	Interferon-alpha/beta receptor, fibronectin type III
10	PF00069 Pkinase	1.3e-41	154.4	Protein kinase domain
11	PF07714 PK_Tyr_Ser-Thr	7.1e-91	315.7	Protein tyrosine and serine/threonine kinase
12	PF16656 Pur_ac_phosph_N	0.033	26.2	Purple acid Phosphatase, N-terminal domain
13	PF00536 SAM_1	1.1e-18	78.8	SAM domain (Sterile alpha motif)
14	PF07647 SAM_2	1.4e-17	74.9	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332118

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245323	0.999	Ephrin-B2
2	9606.ENSP00000204961	0.997	Ephrin-B1
3	9606.ENSP00000226091	0.997	Ephrin-B3
4	9606.ENSP00000383118	0.938	Cell division control protein 42 homolog
5	9606.ENSP00000219070	0.928	72 kDa type IV collagenase
6	9606.ENSP00000348461	0.920	Ras-related C3 botulinum toxin substrate 1
7	9606.ENSP00000217652	0.908	Myosin regulatory light chain 12A
8	9606.ENSP00000294785	0.903	Nicastrin
9	9606.ENSP00000326366	0.903	Presenilin-1
10	9606.ENSP00000361405	0.903	Matrix metalloproteinase-9
11	9606.ENSP00000355747	0.902	Presenilin-2
12	9606.ENSP00000382697	0.902	Rho-associated protein kinase 1
13	9606.ENSP00000261879	0.901	Gamma-secretase subunit APH-1B
14	9606.ENSP00000358105	0.901	Gamma-secretase subunit APH-1A
15	9606.ENSP00000468411	0.900	Gamma-secretase subunit PEN-2
16	9606.ENSP00000264051	0.892	Ephexin-1
17	9606.ENSP00000357392	0.882	Ephrin-A1
18	9606.ENSP00000328777	0.877	Ephrin-A5
19	9606.ENSP00000215368	0.871	Ephrin-A2
20	9606.ENSP00000357393	0.869	Ephrin-A3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005003	1.000	ephrin receptor activity
GO:0042802	0.432	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0009987	0.992	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0007275	0.984	multicellular organism development
GO:0051716	0.982	cellular response to stimulus
GO:0048013	0.971	ephrin receptor signaling pathway
GO:0048870	0.899	cell motility
GO:0048518	0.884	positive regulation of biological process
GO:0071704	0.813	organic substance metabolic process
GO:0044238	0.796	primary metabolic process
GO:0006468	0.794	protein phosphorylation
GO:0048731	0.778	system development
GO:0030155	0.758	regulation of cell adhesion
GO:0016477	0.750	cell migration
GO:0048522	0.728	positive regulation of cellular process
GO:0071840	0.717	cellular component organization or biogenesis
GO:0016043	0.686	cellular component organization
GO:0009653	0.677	anatomical structure morphogenesis
GO:0007155	0.675	cell adhesion
GO:0065009	0.601	regulation of molecular function
GO:0046777	0.598	protein autophosphorylation
GO:0007399	0.585	nervous system development
GO:0048519	0.575	negative regulation of biological process
GO:0019222	0.513	regulation of metabolic process
GO:0051128	0.506	regulation of cellular component organization
GO:0050790	0.493	regulation of catalytic activity
GO:0030154	0.434	cell differentiation
GO:0060255	0.433	regulation of macromolecule metabolic process
GO:0044093	0.410	positive regulation of molecular function
GO:0023051	0.395	regulation of signaling
GO:0010646	0.395	regulation of cell communication
GO:0048523	0.395	negative regulation of cellular process
GO:0048583	0.375	regulation of response to stimulus
GO:0051336	0.353	regulation of hydrolase activity
GO:0009966	0.339	regulation of signal transduction
GO:0080090	0.338	regulation of primary metabolic process
GO:0051171	0.332	regulation of nitrogen compound metabolic process
GO:0051239	0.318	regulation of multicellular organismal process
GO:0031323	0.302	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.963	intracellular anatomical structure
GO:0005737	0.952	cytoplasm
GO:0043226	0.792	organelle
GO:0043227	0.778	membrane-bounded organelle
GO:0005829	0.771	cytosol
GO:0005576	0.610	extracellular region
GO:0043229	0.537	intracellular organelle
GO:0043231	0.520	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	1.000	receptor protein-tyrosine kinase.

[back to server]