StarFunc result for job id P54756

User Input

>input (1037 residues)
MRGSGPRGAGRRRPPSGGGDTPITPASLAGCYSAPRRAPLWTCLLLCAALRTLLASPSNE
VNLLDSRTVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISN
EGASRIFIELKFTLRDCNSLPGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTIAAD
ESFTELDLGDRVMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVYYKKCPSVVRHL
AVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNG
TCQVCRPGFFKASPHIQSCGKCPPHSYTHEEASTSCVCEKDYFRRESDPPTMACTRPPSA
PRNAISNVNETSVFLEWIPPADTGGRKDVSYYIACKKCNSHAGVCEECGGHVRYLPRQSG
LKNTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGARQYVSVNVTTNQAAPSPVTNVKKGKI
AKNSISLSWQEPDRPNGIILEYEIKYFEKDQETSYTIIKSKETTITAEGLKPASVYVFQI
RARTAAGYGVFSRRFEFETTPVFAASSDQSQIPVIAVSVTVGVILLAVVIGVLLSGSCCE
CGCGRASSLCAVAHPSLIWRCGYSKAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYEDPN
QAVHEFAKEIEASCITIERVIGAGEFGEVCSGRLKLPGKRELPVAIKTLKVGYTEKQRRD
FLGEASIMGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQLVGM
LRGISAGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKI
PIRWTAPEAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPSP
MDCPAALYQLMLDCWQKERNSRPKFDEIVNMLDKLIRNPSSLKTLVNASCRVSNLLAEHS
PLGSGAYRSVGEWLEAIKMGRYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKIM
NSLQEMKVQLVNGMVPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4J1T8	0.569	0.529	0.000	1130	0.579	0.531	A0A0B4J1T8.pdb.gz	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	AFDB:A0A0G2JY48	0.468	0.490	0.000	986	0.545	0.573	A0A0G2JY48.pdb.gz	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	AFDB:A0A3B3IRY8	0.431	0.425	0.000	1055	0.527	0.518	A0A3B3IRY8.pdb.gz	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
4	AFDB:F1Q9D9	0.500	0.534	0.000	963	0.601	0.647	F1Q9D9.pdb.gz
5	AFDB:F1RCL1	0.410	0.433	0.000	976	0.594	0.631	F1RCL1.pdb.gz
6	AFDB:O08680	0.435	0.457	0.000	984	0.632	0.666	O08680.pdb.gz	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
7	AFDB:O73875	0.369	0.386	0.000	987	0.467	0.490	O73875.pdb.gz	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
8	AFDB:O73878	0.359	0.378	0.000	976	0.463	0.492	O73878.pdb.gz	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
9	AFDB:P29322	0.442	0.454	0.000	1005	0.555	0.573	P29322.pdb.gz	EPHA8_HUMAN Ephrin type-A receptor 8 OS=Homo sapiens OX=9606 GN=EPHA8 PE=1 SV=2
10	AFDB:P29323	0.475	0.468	0.000	1055	0.553	0.543	P29323.pdb.gz	EPHB2_HUMAN Ephrin type-B receptor 2 OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=5
11	PDB:2h8hA	0.232	0.515	2.386E-22	445	0.136	0.317	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.231	0.532	1.111E-20	441	0.097	0.229	1k9aB.pdb.gz
13	PDB:4fl2A	0.241	0.440	2.442E-20	555	0.098	0.184	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.236	0.432	9.230E-20	551	0.103	0.194	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:8dksA	0.202	0.675	1.381E-14	283	0.068	0.251	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:6s73A	0.218	0.767	3.883E-14	269	0.063	0.242	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:6lk5A	0.220	0.805	7.364E-14	265	0.064	0.249	6lk5A.pdb.gz
18	PDB:7mfdA	0.220	0.510	3.226E-13	410	0.090	0.227	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
19	PDB:4rerA	0.216	0.461	4.553E-13	459	0.079	0.179	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
20	PDB:4zhxA	0.218	0.520	1.001E-12	409	0.068	0.171	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1T8	1266	1130	0.584	0.536	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	A0A0G2JY48	1113	965	0.532	0.572	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	A0A140VJJ0	1405	983	0.640	0.675	A0A140VJJ0_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=2 SV=1
4	A0A3B3IRY8	1112	1055	0.528	0.519	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
5	B1AKC9	1144	946	0.531	0.582	B1AKC9_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=1
6	B2B9B0	1170	986	0.549	0.577	B2B9B0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=2 SV=1
7	C9JXA2	1348	918	0.614	0.694	C9JXA2_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=1 SV=1
8	D1YSF9	711	1005	0.384	0.396	D1YSF9_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=4 SV=1
9	D3ZDH4	784	977	0.403	0.428	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
10	D3ZZK3	1276	949	0.604	0.660	D3ZZK3_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha4 PE=4 SV=2
11	E7EU71	573	547	0.244	0.463	E7EU71_HUMAN EPH receptor A6 OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
12	F1MAJ0	1171	987	0.549	0.576	F1MAJ0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=4
13	O08644	764	1014	0.394	0.403	EPHB6_MOUSE Ephrin type-B receptor 6 OS=Mus musculus OX=10090 GN=Ephb6 PE=2 SV=4
14	O08680	1390	984	0.630	0.664	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
15	O09127	1200	1004	0.551	0.569	EPHA8_MOUSE Ephrin type-A receptor 8 OS=Mus musculus OX=10090 GN=Epha8 PE=1 SV=2
16	O15197	749	1021	0.388	0.394	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
17	O73875	917	987	0.473	0.497	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
18	O73878	925	976	0.477	0.507	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
19	O96435	707	1019	0.394	0.401	O96435_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=2 SV=1
20	P09759	1157	984	0.547	0.576	EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegicus OX=10116 GN=Ephb1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	4.1	18.0	ABC1 atypical kinase-like domain
2	PF16389 DUF4998	1.2e+02	13.7	Domain of unknown function
3	PF14575 EphA2_TM	4.5e-24	96.3	Ephrin type-A receptor 2 transmembrane domain
4	PF01404 Ephrin_lbd	7.7e-66	233.1	Ephrin receptor ligand binding domain
5	PF07699 Ephrin_rec_like	0.33	22.1	Tyrosine-protein kinase ephrin type A/B receptor-like
6	PF00041 fn3	3.4e-27	105.9	Fibronectin type III domain
7	PF16893 fn3_2	34	16.0	Fibronectin type III domain
8	PF12330 Haspin_kinase	2.8e+02	11.9	Haspin like kinase domain
9	PF14279 HNH_5	8	17.8	HNH endonuclease
10	PF09294 Interfer-bind	1e+02	14.6	Interferon-alpha/beta receptor, fibronectin type III
11	PF06293 Kdo	5.6e+02	11.3	Lipopolysaccharide kinase (Kdo/WaaP) family
12	PF00069 Pkinase	2.5e-43	159.9	Protein kinase domain
13	PF17667 Pkinase_fungal	5.6e+02	10.7	Fungal protein kinase
14	PF07714 PK_Tyr_Ser-Thr	2.5e-94	327.0	Protein tyrosine and serine/threonine kinase
15	PF16656 Pur_ac_phosph_N	0.089	24.8	Purple acid Phosphatase, N-terminal domain
16	PF00536 SAM_1	2.9e-18	77.4	SAM domain (Sterile alpha motif)
17	PF07647 SAM_2	1.4e-16	71.6	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000027683

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000049164	0.961	ephrin-A2
2	9598.ENSPTRP00000029298	0.951	ephrin-A5
3	9598.ENSPTRP00000002366	0.939	Uncharacterized protein
4	9598.ENSPTRP00000002368	0.936	Uncharacterized protein
5	9598.ENSPTRP00000002365	0.930	Ephrin-A4
6	9598.ENSPTRP00000029205	0.900	RAS p21 protein activator (GTPase activating protein) 1
7	9598.ENSPTRP00000022308	0.887	Uncharacterized protein
8	9598.ENSPTRP00000010233	0.861	Ephrin-B2
9	9598.ENSPTRP00000053140	0.857	Uncharacterized protein
10	9598.ENSPTRP00000036748	0.811	C-abl oncogene 1, non-receptor tyrosine kinase
11	9598.ENSPTRP00000037780	0.773	ephrin-B1
12	9598.ENSPTRP00000025759	0.716	Ras homolog family member A
13	9598.ENSPTRP00000016724	0.699	Tyrosine-protein kinase
14	9598.ENSPTRP00000023137	0.699	Tyrosine-protein kinase
15	9598.ENSPTRP00000031615	0.699	Tyrosine-protein kinase
16	9598.ENSPTRP00000046608	0.673	Tyrosine-protein kinase
17	9598.ENSPTRP00000000718	0.669	FGR proto-oncogene, Src family tyrosine kinase
18	9598.ENSPTRP00000000842	0.669	LCK proto-oncogene, Src family tyrosine kinase
19	9598.ENSPTRP00000022925	0.669	HCK proto-oncogene, Src family tyrosine kinase
20	9598.ENSPTRP00000048521	0.669	BLK proto-oncogene, Src family tyrosine kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005003	0.999	ephrin receptor activity
GO:0019838	0.307	growth factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050896	0.987	response to stimulus
GO:0050794	0.985	regulation of cellular process
GO:0051716	0.981	cellular response to stimulus
GO:0032501	0.980	multicellular organismal process
GO:0048856	0.962	anatomical structure development
GO:0023052	0.948	signaling
GO:0007399	0.945	nervous system development
GO:0048013	0.944	ephrin receptor signaling pathway
GO:0071840	0.766	cellular component organization or biogenesis
GO:0016043	0.752	cellular component organization
GO:0065009	0.735	regulation of molecular function
GO:0031175	0.674	neuron projection development
GO:0048519	0.638	negative regulation of biological process
GO:0071704	0.622	organic substance metabolic process
GO:0044238	0.615	primary metabolic process
GO:0044237	0.610	cellular metabolic process
GO:0009653	0.608	anatomical structure morphogenesis
GO:0006807	0.601	nitrogen compound metabolic process
GO:0048518	0.592	positive regulation of biological process
GO:0000904	0.572	cell morphogenesis involved in differentiation
GO:0043170	0.561	macromolecule metabolic process
GO:1901564	0.545	organonitrogen compound metabolic process
GO:0019538	0.544	protein metabolic process
GO:0043412	0.515	macromolecule modification
GO:0019222	0.456	regulation of metabolic process
GO:0036211	0.456	protein modification process
GO:0048522	0.432	positive regulation of cellular process
GO:0060255	0.431	regulation of macromolecule metabolic process
GO:0048523	0.426	negative regulation of cellular process
GO:0006796	0.418	phosphate-containing compound metabolic process
GO:0048583	0.411	regulation of response to stimulus
GO:0080090	0.409	regulation of primary metabolic process
GO:0051128	0.405	regulation of cellular component organization
GO:0030155	0.404	regulation of cell adhesion
GO:0042221	0.402	response to chemical
GO:0016310	0.399	phosphorylation
GO:0051171	0.394	regulation of nitrogen compound metabolic process
GO:0023051	0.345	regulation of signaling
GO:0010646	0.334	regulation of cell communication
GO:0050790	0.315	regulation of catalytic activity
GO:0065008	0.301	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.835	intracellular anatomical structure
GO:0005737	0.759	cytoplasm
GO:0043226	0.667	organelle
GO:0043227	0.603	membrane-bounded organelle
GO:0012505	0.480	endomembrane system
GO:0043231	0.395	intracellular membrane-bounded organelle
GO:0042995	0.376	cell projection
GO:0120025	0.350	plasma membrane bounded cell projection
GO:0043005	0.322	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	1.000	receptor protein-tyrosine kinase.

[back to server]