StarFunc result for job id P54760

User Input

>input (987 residues)
MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEV
CDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDA
DTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQD
QGACMALLSLHLFYKKCAQLTVNLTRFPETVPRELVVPVAGSCVVDAVPAPGPSPSLYCR
EDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLSGEGSCQPCPANSHSNTIGSA
VCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESGGREDLTYALR
CRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPV
PFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPS
SVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLAL
IAGTAVVGVVLVLVVIVVAVLCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPN
EAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRRE
FLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGM
LRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGG
KIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLP
PPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLD
QRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKK
ILASVQHMKSQAKPGTPGGTGGPAPQY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4J1T8	0.503	0.450	0.000	1130	0.486	0.425	A0A0B4J1T8.pdb.gz	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	AFDB:A0A0G2JY48	0.454	0.454	0.000	986	0.552	0.553	A0A0G2JY48.pdb.gz	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	AFDB:A0A3B3IRY8	0.451	0.424	0.000	1055	0.545	0.510	A0A3B3IRY8.pdb.gz	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
4	AFDB:F1Q9D9	0.398	0.406	0.000	963	0.459	0.470	F1Q9D9.pdb.gz
5	AFDB:F1RCL1	0.409	0.413	0.000	976	0.484	0.490	F1RCL1.pdb.gz
6	AFDB:O08680	0.410	0.411	0.000	984	0.472	0.474	O08680.pdb.gz	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
7	AFDB:O15197	0.529	0.515	0.000	1021	0.438	0.423	O15197.pdb.gz	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
8	AFDB:O73875	0.541	0.541	0.000	987	0.624	0.624	O73875.pdb.gz	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
9	AFDB:O73878	0.505	0.510	0.000	976	0.592	0.598	O73878.pdb.gz	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
10	AFDB:P29322	0.410	0.403	0.000	1005	0.462	0.454	P29322.pdb.gz	EPHA8_HUMAN Ephrin type-A receptor 8 OS=Homo sapiens OX=9606 GN=EPHA8 PE=1 SV=2
11	PDB:2h8hA	0.244	0.518	1.290E-21	445	0.135	0.299	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.252	0.546	1.219E-20	441	0.118	0.263	1k9aB.pdb.gz
13	PDB:4fl2A	0.250	0.436	6.103E-20	555	0.112	0.200	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.250	0.438	7.790E-20	551	0.126	0.225	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:8dksA	0.211	0.674	1.633E-14	283	0.073	0.254	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:6s73A	0.236	0.798	5.533E-14	269	0.066	0.242	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:6uanB	0.212	0.746	1.208E-13	261	0.082	0.310	6uanB.pdb.gz
18	PDB:6lk5A	0.234	0.802	2.393E-13	265	0.062	0.230	6lk5A.pdb.gz
19	PDB:2qkwB	0.218	0.666	5.488E-13	292	0.072	0.243	2qkwB.pdb.gz
20	PDB:7mfdA	0.235	0.516	5.488E-13	410	0.089	0.215	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1T8	912	1130	0.490	0.428	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	A0A0G2JY48	1035	965	0.533	0.545	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	A0A140VJJ0	935	983	0.485	0.487	A0A140VJJ0_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=2 SV=1
4	A0A3B3IRY8	1063	1055	0.538	0.503	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
5	B1AKC9	1077	946	0.529	0.552	B1AKC9_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=1
6	B2B9B0	1093	986	0.549	0.550	B2B9B0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=2 SV=1
7	C9JXA2	883	918	0.464	0.499	C9JXA2_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=1 SV=1
8	D1YSF9	654	1005	0.385	0.378	D1YSF9_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=4 SV=1
9	D3ZDH4	672	977	0.397	0.401	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
10	D3ZZK3	934	949	0.484	0.504	D3ZZK3_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha4 PE=4 SV=2
11	F1MAJ0	1098	987	0.550	0.550	F1MAJ0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=4
12	O08644	776	1014	0.447	0.435	EPHB6_MOUSE Ephrin type-B receptor 6 OS=Mus musculus OX=10090 GN=Ephb6 PE=2 SV=4
13	O08680	914	984	0.473	0.475	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
14	O09127	837	1004	0.460	0.452	EPHA8_MOUSE Ephrin type-A receptor 8 OS=Mus musculus OX=10090 GN=Epha8 PE=1 SV=2
15	O15197	753	1021	0.432	0.417	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
16	O73875	1221	987	0.629	0.629	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
17	O73878	1183	976	0.591	0.597	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
18	O96435	649	1019	0.396	0.384	O96435_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=2 SV=1
19	P09759	1109	984	0.559	0.561	EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegicus OX=10116 GN=Ephb1 PE=1 SV=2
20	P21709	697	976	0.411	0.416	EPHA1_HUMAN Ephrin type-A receptor 1 OS=Homo sapiens OX=9606 GN=EPHA1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	2	19.0	ABC1 atypical kinase-like domain
2	PF14575 EphA2_TM	2.2e-21	87.7	Ephrin type-A receptor 2 transmembrane domain
3	PF01404 Ephrin_lbd	1.6e-57	206.0	Ephrin receptor ligand binding domain
4	PF07699 Ephrin_rec_like	0.0048	28.0	Tyrosine-protein kinase ephrin type A/B receptor-like
5	PF00041 fn3	1.1e-24	97.8	Fibronectin type III domain
6	PF12330 Haspin_kinase	3.1e+02	11.7	Haspin like kinase domain
7	PF00069 Pkinase	1.4e-41	154.2	Protein kinase domain
8	PF07714 PK_Tyr_Ser-Thr	1.8e-90	314.3	Protein tyrosine and serine/threonine kinase
9	PF16656 Pur_ac_phosph_N	0.26	23.3	Purple acid Phosphatase, N-terminal domain
10	PF00536 SAM_1	6.8e-16	69.8	SAM domain (Sterile alpha motif)
11	PF07647 SAM_2	4.6e-15	66.8	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350896

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245323	0.999	Ephrin-B2
2	9606.ENSP00000204961	0.991	Ephrin-B1
3	9606.ENSP00000274376	0.945	Ras GTPase-activating protein 1
4	9606.ENSP00000328777	0.943	Ephrin-A5
5	9606.ENSP00000263967	0.924	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
6	9606.ENSP00000219070	0.922	72 kDa type IV collagenase
7	9606.ENSP00000226091	0.921	Ephrin-B3
8	9606.ENSP00000361405	0.920	Matrix metalloproteinase-9
9	9606.ENSP00000348461	0.918	Ras-related C3 botulinum toxin substrate 1
10	9606.ENSP00000428056	0.914	Phosphatidylinositol 3-kinase regulatory subunit alpha
11	9606.ENSP00000326366	0.911	Presenilin-1
12	9606.ENSP00000217652	0.910	Myosin regulatory light chain 12A
13	9606.ENSP00000294785	0.907	Nicastrin
14	9606.ENSP00000357392	0.907	Ephrin-A1
15	9606.ENSP00000468411	0.905	Gamma-secretase subunit PEN-2
16	9606.ENSP00000355747	0.904	Presenilin-2
17	9606.ENSP00000358105	0.904	Gamma-secretase subunit APH-1A
18	9606.ENSP00000261879	0.901	Gamma-secretase subunit APH-1B
19	9606.ENSP00000264051	0.880	Ephexin-1
20	9606.ENSP00000215368	0.869	Ephrin-A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005003	0.998	ephrin receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0023052	0.990	signaling
GO:0051716	0.986	cellular response to stimulus
GO:0007165	0.980	signal transduction
GO:0032502	0.979	developmental process
GO:0048856	0.974	anatomical structure development
GO:0032501	0.973	multicellular organismal process
GO:0007166	0.969	cell surface receptor signaling pathway
GO:0007169	0.955	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048013	0.951	ephrin receptor signaling pathway
GO:0007275	0.935	multicellular organism development
GO:0048731	0.905	system development
GO:0009653	0.886	anatomical structure morphogenesis
GO:0048518	0.884	positive regulation of biological process
GO:0048522	0.854	positive regulation of cellular process
GO:0001944	0.826	vasculature development
GO:0071704	0.802	organic substance metabolic process
GO:0016310	0.798	phosphorylation
GO:0035295	0.782	tube development
GO:0044238	0.759	primary metabolic process
GO:0035239	0.739	tube morphogenesis
GO:0016477	0.704	cell migration
GO:0006807	0.698	nitrogen compound metabolic process
GO:0043170	0.676	macromolecule metabolic process
GO:1901564	0.642	organonitrogen compound metabolic process
GO:0019538	0.625	protein metabolic process
GO:0048646	0.596	anatomical structure formation involved in morphogenesis
GO:0036211	0.588	protein modification process
GO:0001568	0.584	blood vessel development
GO:0001525	0.557	angiogenesis
GO:0048519	0.518	negative regulation of biological process
GO:0019222	0.502	regulation of metabolic process
GO:0048583	0.469	regulation of response to stimulus
GO:0060255	0.467	regulation of macromolecule metabolic process
GO:0051239	0.434	regulation of multicellular organismal process
GO:0065009	0.401	regulation of molecular function
GO:0048523	0.373	negative regulation of cellular process
GO:0050790	0.361	regulation of catalytic activity
GO:0030155	0.360	regulation of cell adhesion
GO:0080090	0.351	regulation of primary metabolic process
GO:0006468	0.346	protein phosphorylation
GO:0051171	0.336	regulation of nitrogen compound metabolic process
GO:0010646	0.326	regulation of cell communication
GO:0023051	0.325	regulation of signaling
GO:0009966	0.318	regulation of signal transduction
GO:0009893	0.310	positive regulation of metabolic process
GO:0010604	0.302	positive regulation of macromolecule metabolic process
GO:0050793	0.301	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.965	intracellular anatomical structure
GO:0005576	0.944	extracellular region
GO:0043226	0.940	organelle
GO:0005737	0.940	cytoplasm
GO:0043227	0.915	membrane-bounded organelle
GO:0031982	0.867	vesicle
GO:0005829	0.836	cytosol
GO:0043231	0.763	intracellular membrane-bounded organelle
GO:0005615	0.626	extracellular space
GO:1903561	0.557	extracellular vesicle
GO:0070062	0.403	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	1.000	receptor protein-tyrosine kinase.

[back to server]