StarFunc result for job id P54762

User Input

>input (984 residues)
MALDYLLLLLLASAVAAMEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQV
CNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSV
IATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDY
GACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNAEEVDVPIKLYC
NGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPI
CTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIIC
KKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKSPFPP
QHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFN
SSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLP
LIAGSAAAGVVFVVSLVAISIVCSRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTY
EDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEK
QRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQ
LVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTS
SLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQD
YRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQ
PLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGITLAG
HQKKILNSIHSMRVQISQSPTAMA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4J1T8	0.378	0.332	0.000	1130	0.535	0.465	A0A0B4J1T8.pdb.gz	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	AFDB:A0A0G2JY48	0.391	0.390	0.000	986	0.729	0.727	A0A0G2JY48.pdb.gz	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	AFDB:A0A3B3IRY8	0.356	0.336	0.000	1055	0.964	0.900	A0A3B3IRY8.pdb.gz	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
4	AFDB:D3ZDH4	0.401	0.404	0.000	977	0.422	0.425	D3ZDH4.pdb.gz	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
5	AFDB:F1Q9D9	0.431	0.439	0.000	963	0.535	0.546	F1Q9D9.pdb.gz
6	AFDB:F1RCL1	0.390	0.393	0.000	976	0.558	0.562	F1RCL1.pdb.gz
7	AFDB:O08680	0.458	0.458	0.000	984	0.551	0.551	O08680.pdb.gz	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
8	AFDB:O15197	0.358	0.347	0.000	1021	0.487	0.469	O15197.pdb.gz	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
9	AFDB:O73875	0.382	0.381	0.000	987	0.565	0.563	O73875.pdb.gz	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
10	AFDB:O73878	0.371	0.374	0.000	976	0.546	0.550	O73878.pdb.gz	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
11	PDB:2h8hA	0.244	0.512	1.495E-22	445	0.135	0.299	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:4fl2A	0.254	0.441	4.520E-22	555	0.109	0.193	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:4k2rA	0.251	0.437	2.149E-21	551	0.108	0.192	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:1k9aB	0.250	0.543	6.834E-21	441	0.105	0.234	1k9aB.pdb.gz
15	PDB:8dksA	0.210	0.667	2.296E-15	283	0.075	0.261	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:6s73A	0.235	0.791	2.808E-15	269	0.065	0.238	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:7mfdA	0.233	0.513	3.301E-14	410	0.088	0.212	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
18	PDB:6lk5A	0.237	0.810	4.037E-14	265	0.064	0.238	6lk5A.pdb.gz
19	PDB:6uanB	0.211	0.733	4.464E-14	261	0.089	0.337	6uanB.pdb.gz
20	PDB:4krcA	0.225	0.695	1.570E-13	297	0.064	0.212	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1T8	1094	1130	0.551	0.480	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	A0A0G2JY48	1427	965	0.681	0.694	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	A0A140VJJ0	1127	983	0.552	0.552	A0A140VJJ0_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=2 SV=1
4	A0A3B3IRY8	1985	1055	0.965	0.900	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
5	B1AKC9	1500	946	0.703	0.732	B1AKC9_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=1
6	B2B9B0	1535	986	0.725	0.723	B2B9B0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=2 SV=1
7	C9JXA2	1084	918	0.535	0.573	C9JXA2_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=1 SV=1
8	D1YSF9	735	1005	0.423	0.414	D1YSF9_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=4 SV=1
9	D3ZDH4	736	977	0.416	0.419	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
10	D3ZZK3	1141	949	0.568	0.589	D3ZZK3_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha4 PE=4 SV=2
11	F1MAJ0	1529	987	0.725	0.722	F1MAJ0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=4
12	O08644	951	1014	0.495	0.480	EPHB6_MOUSE Ephrin type-B receptor 6 OS=Mus musculus OX=10090 GN=Ephb6 PE=2 SV=4
13	O08680	1113	984	0.551	0.551	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
14	O09127	1047	1004	0.516	0.506	EPHA8_MOUSE Ephrin type-A receptor 8 OS=Mus musculus OX=10090 GN=Epha8 PE=1 SV=2
15	O15197	930	1021	0.484	0.466	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
16	O73875	1077	987	0.567	0.565	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
17	O73878	1069	976	0.553	0.557	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
18	O96435	735	1019	0.434	0.419	O96435_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=2 SV=1
19	P09759	2039	984	0.989	0.989	EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegicus OX=10116 GN=Ephb1 PE=1 SV=2
20	P21709	745	976	0.428	0.431	EPHA1_HUMAN Ephrin type-A receptor 1 OS=Homo sapiens OX=9606 GN=EPHA1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.0021	28.8	ABC1 atypical kinase-like domain
2	PF12662 cEGF	5.8e+02	11.8	Complement Clr-like EGF-like
3	PF07213 DAP10	2.6e+02	13.0	DAP10 membrane protein
4	PF14575 EphA2_TM	2.2e-24	97.3	Ephrin type-A receptor 2 transmembrane domain
5	PF01404 Ephrin_lbd	5.9e-68	240.0	Ephrin receptor ligand binding domain
6	PF07699 Ephrin_rec_like	2.8	19.1	Tyrosine-protein kinase ephrin type A/B receptor-like
7	PF00041 fn3	1.7e-28	110.1	Fibronectin type III domain
8	PF12330 Haspin_kinase	3.6e+02	11.5	Haspin like kinase domain
9	PF00069 Pkinase	9e-46	168.0	Protein kinase domain
10	PF07714 PK_Tyr_Ser-Thr	3.9e-96	332.9	Protein tyrosine and serine/threonine kinase
11	PF16656 Pur_ac_phosph_N	4	19.5	Purple acid Phosphatase, N-terminal domain
12	PF00536 SAM_1	6.1e-17	73.1	SAM domain (Sterile alpha motif)
13	PF07647 SAM_2	3.1e-15	67.3	SAM domain (Sterile alpha motif)
14	PF03302 VSP	19	15.6	Giardia variant-specific surface protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381097

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000204961	0.999	Ephrin-B1
2	9606.ENSP00000245323	0.999	Ephrin-B2
3	9606.ENSP00000403459	0.997	Growth factor receptor-bound protein 7
4	9606.ENSP00000417273	0.995	Cytoplasmic protein NCK1
5	9606.ENSP00000226091	0.991	Ephrin-B3
6	9606.ENSP00000401303	0.982	SHC-transforming protein 1
7	9606.ENSP00000286827	0.973	T-lymphoma invasion and metastasis-inducing protein 1
8	9606.ENSP00000376345	0.970	Growth factor receptor-bound protein 2
9	9606.ENSP00000328777	0.968	Ephrin-A5
10	9606.ENSP00000357392	0.952	Ephrin-A1
11	9606.ENSP00000233154	0.946	Cytoplasmic protein NCK2
12	9606.ENSP00000394794	0.944	Tyrosine-protein phosphatase non-receptor type 13
13	9606.ENSP00000267257	0.931	Paxillin
14	9606.ENSP00000363255	0.930	Regulator of G-protein signaling 3
15	9606.ENSP00000300574	0.929	Adapter molecule crk
16	9606.ENSP00000407586	0.925	GTPase HRas
17	9606.ENSP00000348461	0.924	Ras-related C3 botulinum toxin substrate 1
18	9606.ENSP00000428056	0.920	Phosphatidylinositol 3-kinase regulatory subunit alpha
19	9606.ENSP00000263967	0.917	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
20	9606.ENSP00000302486	0.917	Dual specificity mitogen-activated protein kinase kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005003	0.998	ephrin receptor activity
GO:0005102	0.323	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.983	response to stimulus
GO:0009987	0.983	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0048731	0.972	system development
GO:0051716	0.968	cellular response to stimulus
GO:0007399	0.963	nervous system development
GO:0048013	0.961	ephrin receptor signaling pathway
GO:0048583	0.881	regulation of response to stimulus
GO:0016043	0.879	cellular component organization
GO:0040011	0.872	locomotion
GO:0048518	0.844	positive regulation of biological process
GO:0030154	0.839	cell differentiation
GO:0030182	0.834	neuron differentiation
GO:1901888	0.819	regulation of cell junction assembly
GO:0051130	0.818	positive regulation of cellular component organization
GO:0080134	0.809	regulation of response to stress
GO:0071704	0.797	organic substance metabolic process
GO:0048468	0.797	cell development
GO:0006468	0.788	protein phosphorylation
GO:0048666	0.786	neuron development
GO:0030030	0.784	cell projection organization
GO:1901890	0.782	positive regulation of cell junction assembly
GO:0009653	0.777	anatomical structure morphogenesis
GO:0048513	0.770	animal organ development
GO:0099173	0.755	postsynapse organization
GO:0048519	0.754	negative regulation of biological process
GO:0060996	0.748	dendritic spine development
GO:0007417	0.747	central nervous system development
GO:0023051	0.746	regulation of signaling
GO:0065008	0.744	regulation of biological quality
GO:0048523	0.743	negative regulation of cellular process
GO:0021954	0.742	central nervous system neuron development
GO:0007155	0.732	cell adhesion
GO:0009605	0.718	response to external stimulus
GO:0009966	0.715	regulation of signal transduction
GO:0051962	0.715	positive regulation of nervous system development
GO:0042221	0.711	response to chemical
GO:0016477	0.698	cell migration
GO:0051965	0.679	positive regulation of synapse assembly
GO:0021535	0.661	cell migration in hindbrain
GO:0042330	0.655	taxis
GO:0048812	0.642	neuron projection morphogenesis
GO:0007409	0.630	axonogenesis
GO:1902531	0.623	regulation of intracellular signal transduction
GO:0008037	0.619	cell recognition
GO:0006935	0.467	chemotaxis
GO:0065009	0.452	regulation of molecular function
GO:0019222	0.451	regulation of metabolic process
GO:0060255	0.413	regulation of macromolecule metabolic process
GO:0050790	0.363	regulation of catalytic activity
GO:0031323	0.349	regulation of cellular metabolic process
GO:0048584	0.328	positive regulation of response to stimulus
GO:0080090	0.327	regulation of primary metabolic process
GO:0051171	0.320	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.944	intracellular anatomical structure
GO:0012505	0.925	endomembrane system
GO:0005737	0.912	cytoplasm
GO:0043226	0.887	organelle
GO:0043227	0.873	membrane-bounded organelle
GO:0043231	0.773	intracellular membrane-bounded organelle
GO:0005829	0.743	cytosol
GO:0030054	0.430	cell junction
GO:0005576	0.374	extracellular region
GO:0031982	0.370	vesicle
GO:0005783	0.327	endoplasmic reticulum
GO:0005634	0.304	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	1.000	receptor protein-tyrosine kinase.

[back to server]