StarFunc result for job id P54764

User Input

>input (986 residues)
MAGIFYFALFSCLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIM
DEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKE
TFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKG
FYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEK
DVPKMYCGADGEWLVPIGNCLCNAGHEERSGECQACKIGYYKALSTDATCAKCPPHSYSV
WEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDI
SYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVS
KYNPNPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYE
KDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRII
GDGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPF
TYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYT
DKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTV
IQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYT
TRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEG
YRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNT
ALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAIT
HQNKILSSVQAMRTQMQQMHGRMVPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4J1T8	0.420	0.369	0.000	1130	0.608	0.530	A0A0B4J1T8.pdb.gz	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	AFDB:A0A0G2JY48	0.427	0.427	0.000	986	0.589	0.589	A0A0G2JY48.pdb.gz	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	AFDB:A0A3B3IRY8	0.584	0.553	0.000	1055	0.562	0.525	A0A3B3IRY8.pdb.gz	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
4	AFDB:F1Q9D9	0.616	0.628	0.000	963	0.601	0.616	F1Q9D9.pdb.gz
5	AFDB:F1RCL1	0.805	0.813	0.000	976	0.665	0.672	F1RCL1.pdb.gz
6	AFDB:O08680	0.507	0.508	0.000	984	0.623	0.624	O08680.pdb.gz	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
7	AFDB:O15197	0.389	0.377	0.000	1021	0.411	0.397	O15197.pdb.gz	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
8	AFDB:O73875	0.484	0.484	0.000	987	0.506	0.506	O73875.pdb.gz	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
9	AFDB:O73878	0.400	0.404	0.000	976	0.501	0.506	O73878.pdb.gz	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
10	AFDB:P29322	0.840	0.825	0.000	1005	0.563	0.552	P29322.pdb.gz	EPHA8_HUMAN Ephrin type-A receptor 8 OS=Homo sapiens OX=9606 GN=EPHA8 PE=1 SV=2
11	PDB:2h8hA	0.244	0.514	1.692E-22	445	0.147	0.326	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.248	0.542	2.121E-20	441	0.101	0.227	1k9aB.pdb.gz
13	PDB:4fl2A	0.249	0.433	2.578E-20	555	0.115	0.204	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.250	0.437	2.554E-19	551	0.105	0.189	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:8dksA	0.214	0.679	2.109E-14	283	0.068	0.237	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:6s73A	0.235	0.799	1.896E-13	269	0.061	0.223	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:6lk5A	0.233	0.806	2.668E-13	265	0.060	0.223	6lk5A.pdb.gz
18	PDB:6uanB	0.213	0.744	3.243E-13	261	0.088	0.333	6uanB.pdb.gz
19	PDB:5dykA	0.237	0.286	3.942E-13	809	0.120	0.146	5dykA.pdb.gz
20	PDB:4rerA	0.227	0.461	5.032E-13	459	0.085	0.183	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1T8	1246	1130	0.613	0.535	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	A0A0G2JY48	1125	965	0.562	0.574	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	A0A140VJJ0	1296	983	0.624	0.626	A0A140VJJ0_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=2 SV=1
4	A0A3B3IRY8	1156	1055	0.568	0.531	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
5	B1AKC9	1154	946	0.567	0.591	B1AKC9_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=1
6	B2B9B0	1186	986	0.586	0.586	B2B9B0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=2 SV=1
7	C9JXA2	1250	918	0.604	0.649	C9JXA2_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=1 SV=1
8	D1YSF9	724	1005	0.413	0.405	D1YSF9_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=4 SV=1
9	D3ZDH4	803	977	0.438	0.442	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
10	D3ZZK3	1956	949	0.949	0.986	D3ZZK3_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha4 PE=4 SV=2
11	E7EU71	567	547	0.262	0.472	E7EU71_HUMAN EPH receptor A6 OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
12	F1MAJ0	1181	987	0.585	0.585	F1MAJ0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=4
13	O08644	810	1014	0.430	0.418	EPHB6_MOUSE Ephrin type-B receptor 6 OS=Mus musculus OX=10090 GN=Ephb6 PE=2 SV=4
14	O08680	1286	984	0.626	0.627	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
15	O09127	1177	1004	0.562	0.552	EPHA8_MOUSE Ephrin type-A receptor 8 OS=Mus musculus OX=10090 GN=Epha8 PE=1 SV=2
16	O13148	559	292	0.269	0.908	EPA4A_DANRE Ephrin type-A receptor 4a (Fragment) OS=Danio rerio OX=7955 GN=epha4a PE=2 SV=1
17	O15197	786	1021	0.417	0.403	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
18	O73875	966	987	0.512	0.512	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
19	O73878	971	976	0.513	0.518	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
20	O96435	721	1019	0.418	0.404	O96435_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	92	13.6	ABC1 atypical kinase-like domain
2	PF06365 CD34_antigen	5.3e+02	11.6	CD34/Podocalyxin family
3	PF19904 DUF6377	4.1e+02	11.9	Domain of unknown function (DUF6377)
4	PF20087 DUF6479	3.6e+02	13.2	Family of unknown function (DUF6479)
5	PF14575 EphA2_TM	1.1e-21	88.7	Ephrin type-A receptor 2 transmembrane domain
6	PF01404 Ephrin_lbd	2.9e-70	247.5	Ephrin receptor ligand binding domain
7	PF07699 Ephrin_rec_like	0.16	23.1	Tyrosine-protein kinase ephrin type A/B receptor-like
8	PF00041 fn3	1.4e-27	107.2	Fibronectin type III domain
9	PF16893 fn3_2	1	20.9	Fibronectin type III domain
10	PF12330 Haspin_kinase	3.1e+02	11.7	Haspin like kinase domain
11	PF09294 Interfer-bind	75	15.0	Interferon-alpha/beta receptor, fibronectin type III
12	PF06293 Kdo	2.8e+02	12.3	Lipopolysaccharide kinase (Kdo/WaaP) family
13	PF19431 MEKK4_N	7e+02	9.2	MEKK4 N-terminal
14	PF00069 Pkinase	8.2e-42	155.0	Protein kinase domain
15	PF07714 PK_Tyr_Ser-Thr	3.9e-93	323.0	Protein tyrosine and serine/threonine kinase
16	PF16656 Pur_ac_phosph_N	2.5	20.1	Purple acid Phosphatase, N-terminal domain
17	PF00536 SAM_1	7.1e-13	60.1	SAM domain (Sterile alpha motif)
18	PF07647 SAM_2	3.7e-16	70.3	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281821

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215368	0.999	Ephrin-A2
2	9606.ENSP00000226091	0.999	Ephrin-B3
3	9606.ENSP00000245323	0.999	Ephrin-B2
4	9606.ENSP00000264051	0.999	Ephexin-1
5	9606.ENSP00000328777	0.999	Ephrin-A5
6	9606.ENSP00000357392	0.999	Ephrin-A1
7	9606.ENSP00000357393	0.999	Ephrin-A3
8	9606.ENSP00000426741	0.995	Ephrin-A3
9	9606.ENSP00000414378	0.990	Ephrin-A4
10	9606.ENSP00000355026	0.983	Rho guanine nucleotide exchange factor 15
11	9606.ENSP00000204961	0.981	Ephrin-B1
12	9606.ENSP00000346671	0.956	Tyrosine-protein kinase Fyn
13	9606.ENSP00000400175	0.955	Transforming protein RhoA
14	9606.ENSP00000362680	0.939	Proto-oncogene tyrosine-protein kinase Src
15	9606.ENSP00000360916	0.936	Guanine nucleotide exchange factor VAV2
16	9606.ENSP00000359073	0.928	Guanine nucleotide exchange factor VAV3
17	9606.ENSP00000419782	0.928	Cyclin-dependent-like kinase 5
18	9606.ENSP00000244007	0.924	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
19	9606.ENSP00000264033	0.922	E3 ubiquitin-protein ligase CBL
20	9606.ENSP00000351209	0.917	Ephrin type-A receptor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0004713	0.996	protein tyrosine kinase activity
GO:0060089	0.970	molecular transducer activity
GO:0038023	0.945	signaling receptor activity
GO:0004888	0.916	transmembrane signaling receptor activity
GO:0004714	0.815	transmembrane receptor protein tyrosine kinase activity
GO:0005102	0.649	signaling receptor binding
GO:0005003	0.618	ephrin receptor activity
GO:0019899	0.517	enzyme binding
GO:0001540	0.445	amyloid-beta binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0050896	0.986	response to stimulus
GO:0032501	0.983	multicellular organismal process
GO:0051128	0.982	regulation of cellular component organization
GO:0048856	0.981	anatomical structure development
GO:0048583	0.976	regulation of response to stimulus
GO:0051716	0.974	cellular response to stimulus
GO:0048518	0.973	positive regulation of biological process
GO:0048731	0.970	system development
GO:0048519	0.964	negative regulation of biological process
GO:0007399	0.964	nervous system development
GO:0120035	0.957	regulation of plasma membrane bounded cell projection organization
GO:0048013	0.946	ephrin receptor signaling pathway
GO:0022603	0.941	regulation of anatomical structure morphogenesis
GO:0065009	0.932	regulation of molecular function
GO:0043408	0.929	regulation of MAPK cascade
GO:0019222	0.925	regulation of metabolic process
GO:0010975	0.924	regulation of neuron projection development
GO:0080134	0.921	regulation of response to stress
GO:0060255	0.915	regulation of macromolecule metabolic process
GO:0048522	0.901	positive regulation of cellular process
GO:0051246	0.898	regulation of protein metabolic process
GO:0050790	0.888	regulation of catalytic activity
GO:1903034	0.885	regulation of response to wounding
GO:0080135	0.880	regulation of cellular response to stress
GO:0051336	0.876	regulation of hydrolase activity
GO:0051174	0.853	regulation of phosphorus metabolic process
GO:0051239	0.851	regulation of multicellular organismal process
GO:1904645	0.848	response to amyloid-beta
GO:0048523	0.845	negative regulation of cellular process
GO:0030155	0.844	regulation of cell adhesion
GO:0010647	0.843	positive regulation of cell communication
GO:0071840	0.840	cellular component organization or biogenesis
GO:0032101	0.839	regulation of response to external stimulus
GO:0031345	0.837	negative regulation of cell projection organization
GO:0008152	0.830	metabolic process
GO:0071704	0.819	organic substance metabolic process
GO:0065008	0.816	regulation of biological quality
GO:0044237	0.816	cellular metabolic process
GO:0030154	0.812	cell differentiation
GO:0010977	0.809	negative regulation of neuron projection development
GO:0001932	0.808	regulation of protein phosphorylation
GO:0044087	0.807	regulation of cellular component biogenesis
GO:0023056	0.807	positive regulation of signaling
GO:0051130	0.800	positive regulation of cellular component organization
GO:0070887	0.794	cellular response to chemical stimulus
GO:0016310	0.788	phosphorylation
GO:0016043	0.786	cellular component organization
GO:0044238	0.785	primary metabolic process
GO:0051094	0.739	positive regulation of developmental process
GO:0048584	0.733	positive regulation of response to stimulus
GO:2000026	0.731	regulation of multicellular organismal development
GO:0044093	0.730	positive regulation of molecular function
GO:0070571	0.729	negative regulation of neuron projection regeneration
GO:0006807	0.726	nitrogen compound metabolic process
GO:0022008	0.725	neurogenesis
GO:0048679	0.717	regulation of axon regeneration
GO:0040012	0.708	regulation of locomotion
GO:1903035	0.704	negative regulation of response to wounding
GO:0030182	0.701	neuron differentiation
GO:0043085	0.700	positive regulation of catalytic activity
GO:0051240	0.686	positive regulation of multicellular organismal process
GO:0009653	0.681	anatomical structure morphogenesis
GO:0009893	0.680	positive regulation of metabolic process
GO:0043170	0.673	macromolecule metabolic process
GO:1901564	0.669	organonitrogen compound metabolic process
GO:0010604	0.668	positive regulation of macromolecule metabolic process
GO:0048513	0.659	animal organ development
GO:0051247	0.659	positive regulation of protein metabolic process
GO:0048468	0.657	cell development
GO:0050807	0.656	regulation of synapse organization
GO:0009888	0.634	tissue development
GO:0000904	0.631	cell morphogenesis involved in differentiation
GO:0045595	0.627	regulation of cell differentiation
GO:0036211	0.617	protein modification process
GO:0010941	0.615	regulation of cell death
GO:0120036	0.611	plasma membrane bounded cell projection organization
GO:0070372	0.609	regulation of ERK1 and ERK2 cascade
GO:0006468	0.597	protein phosphorylation
GO:0048666	0.585	neuron development
GO:0007417	0.579	central nervous system development
GO:0043087	0.551	regulation of GTPase activity
GO:0009892	0.498	negative regulation of metabolic process
GO:0050767	0.486	regulation of neurogenesis
GO:0051241	0.427	negative regulation of multicellular organismal process
GO:0009967	0.408	positive regulation of signal transduction
GO:2000145	0.318	regulation of cell motility

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.931	intracellular anatomical structure
GO:0043226	0.917	organelle
GO:0005737	0.868	cytoplasm
GO:0012505	0.855	endomembrane system
GO:0043227	0.808	membrane-bounded organelle
GO:0043231	0.614	intracellular membrane-bounded organelle
GO:0030054	0.603	cell junction
GO:0005829	0.597	cytosol
GO:0005576	0.420	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	0.996	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.1	0.815	receptor protein-tyrosine kinase.

[back to server]