StarFunc result for job id P54792

User Input

>input (670 residues)
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEIFDDNAKLPCFNGRVVSWLVLVEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRSPSF
QPDVASSRDGMDNETGTESMVSHRRDRARRRNREEAARTNGHPRGDRRRDVGLPPDSAST
ALSSELESSSFVDSDEDDSTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQADRASSFSSM
TDSTMSLNIITVTLNMERHHFLGICIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVPRPDPVRPIDP
AAWLSHTAALTGALPRPQLEEAPLTVESDMNTVVRVMQLPDSGLEIRDRMWLKITIANAV
IGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNKITFSEQCYYVFGDLCSNLA
TLNLNSGSSGTSDQDTLAPLPHPAAPWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGSGST
GSQQSEGSKSSGSTRNTLRPPACEKERRAAGSGDSDSESDHTAPSGVGSSWRERPADQLS
RGSSPRSQASSYAPGLPPPHPTTKAYTVVGGPPGGPPVRELAAVPPELTGSRQSFQKAMG
NPCEFFVDIM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P54792	0.999	0.999	0.000	670	1.000	1.000	P54792.pdb.gz	DVLP1_HUMAN Putative segment polarity protein dishevelled homolog DVL1P1 OS=Homo sapiens OX=9606 GN=DVL1P1 PE=5 SV=1
2	AFDB:O14640	0.243	0.237	1.058E-100	695	0.963	0.928	O14640.pdb.gz	DVL1_HUMAN Segment polarity protein dishevelled homolog DVL-1 OS=Homo sapiens OX=9606 GN=DVL1 PE=1 SV=2
3	AFDB:D4ADV8	0.271	0.256	5.575E-74	716	0.661	0.619	D4ADV8.pdb.gz	D4ADV8_RAT Dishevelled segment polarity protein 3 OS=Rattus norvegicus OX=10116 GN=Dvl3 PE=1 SV=3
4	AFDB:Q6DKE2	0.324	0.307	6.451E-72	717	0.664	0.621	Q6DKE2.pdb.gz	DVL3_XENLA Segment polarity protein dishevelled homolog DVL-3 OS=Xenopus laevis OX=8355 GN=dvl3 PE=2 SV=1
5	AFDB:F1QM97	0.245	0.224	2.796E-71	747	0.643	0.577	F1QM97.pdb.gz
6	AFDB:D3ZB71	0.281	0.261	3.915E-70	736	0.639	0.582	D3ZB71.pdb.gz	D3ZB71_RAT Dishevelled segment polarity protein 2 OS=Rattus norvegicus OX=10116 GN=Dvl2 PE=3 SV=2
7	AFDB:B8JMI2	0.281	0.280	4.029E-68	676	0.621	0.615	B8JMI2.pdb.gz	B8JMI2_DANRE Dishevelled segment polarity protein 3a OS=Danio rerio OX=7955 GN=dvl3 PE=1 SV=1
8	AFDB:P51142	0.296	0.274	1.905E-65	736	0.622	0.567	P51142.pdb.gz	DVL2_XENLA Segment polarity protein dishevelled homolog DVL-2 OS=Xenopus laevis OX=8355 GN=dvl2 PE=1 SV=1
9	AFDB:Q86TH3	0.138	0.206	1.295E-51	444	0.628	0.948	Q86TH3.pdb.gz	Q86TH3_HUMAN Dishevelled, dsh homolog 1 (Drosophila) OS=Homo sapiens OX=9606 GN=DVL1 PE=1 SV=1
10	AFDB:A0A2K1L2D9	0.123	0.129	1.116E-6	636	0.142	0.149	A0A2K1L2D9.pdb.gz	SOK2_PHYPA Protein SOSEKI 2 OS=Physcomitrium patens OX=3218 GN=SOK2 PE=1 SV=1
11	PDB:7pc3A	0.121	0.197	2.057E-5	405	0.048	0.079	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
12	PDB:7pc5A	0.124	0.202	3.921E-5	405	0.039	0.064	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	PDB:7p73A	0.122	0.191	4.958E-5	420	0.048	0.076	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
14	PDB:7qqmA	0.124	0.197	7.049E-5	413	0.037	0.061	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	PDB:2xkxA	0.128	0.120	8.406E-5	721	0.058	0.054	2xkxA.pdb.gz
16	PDB:5n7dA	0.124	0.193	1.802E-4	423	0.033	0.052	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
17	PDB:7p70A	0.119	0.190	2.562E-4	407	0.036	0.059	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
18	PDB:7pcbA	0.110	0.172	5.492E-4	415	0.051	0.082	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:4f7zA	0.113	0.081	6.944E-4	946	0.052	0.037	4f7zA.pdb.gz
20	PDB:6t36A	0.118	0.711	9.873E-4	93	0.016	0.118	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GKX7	0.0	607	727	0.600	0.553	A0A8I6GKX7_RAT Dishevelled segment polarity protein 3 OS=Rattus norvegicus OX=10116 GN=Dvl3 PE=1 SV=1
2	B8JMI2	0.0	663	676	0.609	0.604	B8JMI2_DANRE Dishevelled segment polarity protein 3a OS=Danio rerio OX=7955 GN=dvl3 PE=1 SV=1
3	D3ZB71	0.0	659	736	0.630	0.573	D3ZB71_RAT Dishevelled segment polarity protein 2 OS=Rattus norvegicus OX=10116 GN=Dvl2 PE=3 SV=2
4	D4ADV8	0.0	696	718	0.646	0.603	D4ADV8_RAT Dishevelled segment polarity protein 3 OS=Rattus norvegicus OX=10116 GN=Dvl3 PE=1 SV=3
5	I3L2N2	0.0	634	730	0.619	0.568	I3L2N2_HUMAN Dishevelled segment polarity protein 2 OS=Homo sapiens OX=9606 GN=DVL2 PE=1 SV=1
6	O14640	0.0	1099	695	0.963	0.928	DVL1_HUMAN Segment polarity protein dishevelled homolog DVL-1 OS=Homo sapiens OX=9606 GN=DVL1 PE=1 SV=2
7	O14641	0.0	647	736	0.622	0.567	DVL2_HUMAN Segment polarity protein dishevelled homolog DVL-2 OS=Homo sapiens OX=9606 GN=DVL2 PE=1 SV=1
8	P51141	0.0	1095	695	0.924	0.891	DVL1_MOUSE Segment polarity protein dishevelled homolog DVL-1 OS=Mus musculus OX=10090 GN=Dvl1 PE=1 SV=2
9	P51142	0.0	606	736	0.536	0.488	DVL2_XENLA Segment polarity protein dishevelled homolog DVL-2 OS=Xenopus laevis OX=8355 GN=dvl2 PE=1 SV=1
10	P54792	0.0	1378	670	1.000	1.000	DVLP1_HUMAN Putative segment polarity protein dishevelled homolog DVL1P1 OS=Homo sapiens OX=9606 GN=DVL1P1 PE=5 SV=1
11	Q60838	0.0	662	736	0.627	0.571	DVL2_MOUSE Segment polarity protein dishevelled homolog DVL-2 OS=Mus musculus OX=10090 GN=Dvl2 PE=1 SV=2
12	Q61062	0.0	711	716	0.655	0.613	DVL3_MOUSE Segment polarity protein dishevelled homolog DVL-3 OS=Mus musculus OX=10090 GN=Dvl3 PE=1 SV=2
13	Q6DKE2	0.0	784	717	0.664	0.621	DVL3_XENLA Segment polarity protein dishevelled homolog DVL-3 OS=Xenopus laevis OX=8355 GN=dvl3 PE=2 SV=1
14	Q803Q5	0.0	689	747	0.627	0.562	Q803Q5_DANRE Dishevelled, dsh homolog 2 (Drosophila) OS=Danio rerio OX=7955 GN=wu:fo71e09 PE=1 SV=1
15	Q92997	0.0	714	716	0.657	0.615	DVL3_HUMAN Segment polarity protein dishevelled homolog DVL-3 OS=Homo sapiens OX=9606 GN=DVL3 PE=1 SV=2
16	Q9WVB9	0.0	1097	695	0.925	0.892	DVL1_RAT Segment polarity protein dishevelled homolog DVL-1 OS=Rattus norvegicus OX=10116 GN=Dvl1 PE=1 SV=3
17	P51140	7.80e-142	429	623	0.366	0.393	DSH_DROME Segment polarity protein dishevelled OS=Drosophila melanogaster OX=7227 GN=dsh PE=1 SV=2
18	Q86TH3	1.17e-118	363	444	0.328	0.495	Q86TH3_HUMAN Dishevelled, dsh homolog 1 (Drosophila) OS=Homo sapiens OX=9606 GN=DVL1 PE=1 SV=1
19	B7WN58	1.12e-96	312	636	0.333	0.351	B7WN58_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=1
20	H2KZ17	1.60e-96	314	702	0.333	0.318	H2KZ17_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02724 CDC45	3.5e+02	10.9	CDC45-like protein
2	PF00610 DEP	1.6e-12	58.6	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
3	PF02377 Dishevelled	8e-56	200.3	Dishevelled specific domain
4	PF00778 DIX	4.7e-26	101.8	DIX domain
5	PF12316 Dsh_C	1.6e-49	180.7	Segment polarity protein dishevelled (Dsh) C terminal
6	PF00595 PDZ	4.3e-16	70.4	PDZ domain
7	PF13180 PDZ_2	1.6e+02	14.0	PDZ domain
8	PF17820 PDZ_6	0.51	21.6	PDZ domain
9	PF04917 Shufflon_N	1.3e+02	13.5	Bacterial shufflon protein, N-terminal constant region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000005721

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000008683	0.988	VANGL planar cell polarity protein 1
2	9555.ENSPANP00000013446	0.986	Uncharacterized protein
3	9555.ENSPANP00000016496	0.985	Axin 2
4	9555.ENSPANP00000009188	0.976	Frizzled class receptor 5
5	9555.ENSPANP00000008458	0.975	Frizzled class receptor 7
6	9555.ENSPANP00000012679	0.975	Naked cuticle homolog 1 (Drosophila)
7	9555.ENSPANP00000004139	0.974	Naked cuticle homolog 2 (Drosophila)
8	9555.ENSPANP00000018341	0.972	Prickle planar cell polarity protein 1
9	9555.ENSPANP00000005934	0.971	Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes.
10	9555.ENSPANP00000019605	0.971	Dishevelled segment polarity protein 2
11	9555.ENSPANP00000010830	0.970	Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes.
12	9555.ENSPANP00000003979	0.969	Frizzled class receptor 4
13	9555.ENSPANP00000020754	0.969	FRAT1, WNT signaling pathway regulator
14	9555.ENSPANP00000019013	0.966	Frizzled class receptor 6
15	9555.ENSPANP00000017020	0.965	Dishevelled associated activator of morphogenesis 1
16	9555.ENSPANP00000009337	0.964	Papio anubis frizzled family receptor 1 (FZD1), mRNA
17	9555.ENSPANP00000006569	0.962	Frizzled class receptor 3
18	9555.ENSPANP00000013318	0.962	Casein kinase 1, epsilon
19	9555.ENSPANP00000005232	0.961	Glycogen synthase kinase 3 beta
20	9555.ENSPANP00000019037	0.961	Inversin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005102	0.843	signaling receptor binding
GO:0019899	0.559	enzyme binding
GO:0019901	0.401	protein kinase binding
GO:0005109	0.391	frizzled binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0051716	0.989	cellular response to stimulus
GO:0007154	0.985	cell communication
GO:0048522	0.984	positive regulation of cellular process
GO:0007165	0.983	signal transduction
GO:0007267	0.972	cell-cell signaling
GO:0007166	0.968	cell surface receptor signaling pathway
GO:0060070	0.959	canonical Wnt signaling pathway
GO:0019222	0.951	regulation of metabolic process
GO:0048856	0.947	anatomical structure development
GO:0050793	0.888	regulation of developmental process
GO:0051171	0.884	regulation of nitrogen compound metabolic process
GO:0023051	0.875	regulation of signaling
GO:0080090	0.853	regulation of primary metabolic process
GO:0010646	0.843	regulation of cell communication
GO:0009653	0.840	anatomical structure morphogenesis
GO:0032501	0.837	multicellular organismal process
GO:0060255	0.797	regulation of macromolecule metabolic process
GO:0007275	0.789	multicellular organism development
GO:0090175	0.777	regulation of establishment of planar polarity
GO:0048731	0.731	system development
GO:0031323	0.729	regulation of cellular metabolic process
GO:0009888	0.684	tissue development
GO:0048583	0.678	regulation of response to stimulus
GO:0071840	0.634	cellular component organization or biogenesis
GO:0002009	0.616	morphogenesis of an epithelium
GO:0048519	0.607	negative regulation of biological process
GO:0016043	0.596	cellular component organization
GO:0009893	0.553	positive regulation of metabolic process
GO:0010604	0.511	positive regulation of macromolecule metabolic process
GO:0048523	0.502	negative regulation of cellular process
GO:0065008	0.500	regulation of biological quality
GO:0009966	0.494	regulation of signal transduction
GO:0051173	0.488	positive regulation of nitrogen compound metabolic process
GO:0051246	0.478	regulation of protein metabolic process
GO:0031325	0.477	positive regulation of cellular metabolic process
GO:0035567	0.473	non-canonical Wnt signaling pathway
GO:0051128	0.465	regulation of cellular component organization
GO:0031399	0.465	regulation of protein modification process
GO:0065009	0.428	regulation of molecular function
GO:0010468	0.426	regulation of gene expression
GO:0031326	0.426	regulation of cellular biosynthetic process
GO:0010556	0.424	regulation of macromolecule biosynthetic process
GO:0019219	0.421	regulation of nucleobase-containing compound metabolic process
GO:0007399	0.406	nervous system development
GO:0051252	0.365	regulation of RNA metabolic process
GO:0051174	0.343	regulation of phosphorus metabolic process
GO:0051247	0.322	positive regulation of protein metabolic process
GO:0006355	0.311	regulation of DNA-templated transcription
GO:0048584	0.308	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0071944	0.996	cell periphery
GO:0043227	0.978	membrane-bounded organelle
GO:0043231	0.970	intracellular membrane-bounded organelle
GO:0005829	0.965	cytosol
GO:0043232	0.944	intracellular non-membrane-bounded organelle
GO:0016020	0.943	membrane
GO:0005886	0.879	plasma membrane
GO:0031982	0.778	vesicle
GO:0042995	0.732	cell projection
GO:0032991	0.685	protein-containing complex
GO:0120025	0.681	plasma membrane bounded cell projection
GO:0012505	0.647	endomembrane system
GO:0015630	0.622	microtubule cytoskeleton
GO:0097708	0.587	intracellular vesicle
GO:0031410	0.543	cytoplasmic vesicle
GO:0005634	0.395	nucleus
GO:0070013	0.364	intracellular organelle lumen
GO:0031981	0.340	nuclear lumen
GO:0043005	0.334	neuron projection
GO:0005654	0.307	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]