StarFunc result for job id P54803

User Input

>input (685 residues)
MAEWLLSASWQRRAKAMTAAAGSAGRAAVPLLLCALLAPGGAYVLDDSDGLGREFDGIGA
VSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYA
LDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIV
GAKRYHDLDIDYIGIWNERSYNANYIKILRKMLNYQGLQRVKIIASDNLWESISASMLLD
AELFKVVDVIGAHYPGTHSAKDAKLTGKKLWSSEDFSTLNSDMGAGCWGRILNQNYINGY
MTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKT
VGHLEKGGSYVALTDGLGNLTIIIETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFSEI
PELQVWYTKLGKTSERFLFKQLDSLWLLDSDGSFTLSLHEDELFTLTTLTTGRKGSYPLP
PKSQPFPSTYKDDFNVDYPFFSEAPNFADQTGVFEYFTNIEDPGEHHFTLRQVLNQRPIT
WAADASNTISIIGDYNWTNLTIKCDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFWIF
ANGSYRVTGDLAGWIIYALGRVEVTAKKWYTLTLTIKGHFTSGMLNDKSLWTDIPVNFPK
NGWAAIGTHSFEFAQFDNFLVEATR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4uflA	0.933	0.997	0.000	641	0.781	0.835	4uflA.pdb.gz	Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
2	AFDB:F1QYH2	0.933	0.963	0.000	664	0.613	0.633	F1QYH2.pdb.gz
3	AFDB:P54803	1.000	1.000	0.000	685	1.000	1.000	P54803.pdb.gz	GALC_HUMAN Galactocerebrosidase OS=Homo sapiens OX=9606 GN=GALC PE=1 SV=3
4	AFDB:P54818	0.952	0.954	0.000	684	0.826	0.827	P54818.pdb.gz	GALC_MOUSE Galactocerebrosidase OS=Mus musculus OX=10090 GN=Galc PE=1 SV=2
5	AFDB:Q5SNX7	0.946	0.981	0.000	660	0.613	0.636	Q5SNX7.pdb.gz	GALC_DANRE Galactocerebrosidase OS=Danio rerio OX=7955 GN=galc PE=2 SV=1
6	AFDB:Q4WBR2	0.447	0.608	2.067E-20	488	0.123	0.172	Q4WBR2.pdb.gz	NEG1_ASPFU Endo-1,6-beta-D-glucanase neg1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=neg1 PE=1 SV=1
7	AFDB:Q8J0I9	0.435	0.588	3.728E-20	490	0.123	0.171	Q8J0I9.pdb.gz	GUN16_TRIHA Endo-1,6-beta-D-glucanase BGN16.3 OS=Trichoderma harzianum OX=5544 PE=1 SV=1
8	AFDB:E0SCM6	0.457	0.734	7.501E-19	413	0.111	0.184	E0SCM6.pdb.gz	E0SCM6_DICD3 Xylanase OS=Dickeya dadantii (strain 3937) OX=198628 GN=xynA PE=3 SV=1
9	AFDB:Q8IMY3	0.468	0.558	4.662E-16	566	0.105	0.127	Q8IMY3.pdb.gz	Q8IMY3_DROME Glucosylceramidase OS=Drosophila melanogaster OX=7227 GN=Gba1b PE=3 SV=3
10	AFDB:E7EZM1	0.461	0.598	7.968E-16	518	0.098	0.129	E7EZM1.pdb.gz	E7EZM1_DANRE Glucosylceramidase OS=Danio rerio OX=7955 GN=gba1 PE=1 SV=1
11	AFDB:B2RYC9	0.475	0.621	1.516E-15	515	0.112	0.150	B2RYC9.pdb.gz	B2RYC9_RAT Glucosylceramidase OS=Rattus norvegicus OX=10116 GN=Gba1 PE=2 SV=1
12	PDB:2v3eA	0.472	0.636	2.149E-15	498	0.105	0.145	2v3eA.pdb.gz	Crystal Structures of Complexes of N-Butyl- and N-Nonyl-Deoxynojirimycin Bound to Acid Beta-Glucosidase: Insights Into the Mechanism of Chemical Chaperone Action in Gaucher Disease.
13	PDB:7eyoA	0.380	0.506	5.717E-9	486	0.098	0.138	7eyoA.pdb.gz
14	PDB:5bxaA	0.355	0.546	1.583E-8	414	0.061	0.101	5bxaA.pdb.gz	Characterization of the Pseudomonas aeruginosa Glycoside Hydrolase PslG Reveals That Its Levels Are Critical for Psl Polysaccharide Biosynthesis and Biofilm Formation.
15	PDB:5la4A	0.355	0.457	1.674E-7	508	0.095	0.128	5la4A.pdb.gz	Activity-based probes for functional interrogation of retaining beta-glucuronidases.
16	PDB:5jowA	0.194	0.252	3.185E-7	504	0.066	0.089	5jowA.pdb.gz
17	PDB:1uasA	0.281	0.452	1.036E-6	362	0.074	0.141	1uasA.pdb.gz	Crystal structure of rice alpha-galactosidase complexed with D-galactose
18	PDB:1j0hA	0.271	0.307	1.590E-6	588	0.085	0.099	1j0hA.pdb.gz	Three-dimensional Structure and Substrate Binding of Bacillus stearothermophilus Neopullulanase
19	PDB:5jozA	0.202	0.260	1.590E-6	507	0.077	0.105	5jozA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
20	PDB:7kdvA	0.280	0.313	1.867E-6	600	0.108	0.123	7kdvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P54803	0.0	1414	685	1.000	1.000	GALC_HUMAN Galactocerebrosidase OS=Homo sapiens OX=9606 GN=GALC PE=1 SV=3
2	P54818	0.0	1157	684	0.826	0.827	GALC_MOUSE Galactocerebrosidase OS=Mus musculus OX=10090 GN=Galc PE=1 SV=2
3	Q5SNX7	0.0	858	660	0.612	0.635	GALC_DANRE Galactocerebrosidase OS=Danio rerio OX=7955 GN=galc PE=2 SV=1
4	Q7ZUD5	0.0	842	664	0.612	0.631	Q7ZUD5_DANRE Galactocerebrosidase OS=Danio rerio OX=7955 GN=zgc:56444 PE=2 SV=1
5	Q8J0I9	1.2	34.7	490	0.050	0.069	GUN16_TRIHA Endo-1,6-beta-D-glucanase BGN16.3 OS=Trichoderma harzianum OX=5544 PE=1 SV=1
6	Q8WUJ3	2.3	34.3	1361	0.047	0.024	CEMIP_HUMAN Cell migration-inducing and hyaluronan-binding protein OS=Homo sapiens OX=9606 GN=CEMIP PE=1 SV=2
7	Q8BI06	6.3	32.7	1361	0.039	0.020	CEMIP_MOUSE Cell migration-inducing and hyaluronan-binding protein OS=Mus musculus OX=10090 GN=Cemip PE=1 SV=4
8	Q4WBR2	7.4	32.3	488	0.015	0.020	NEG1_ASPFU Endo-1,6-beta-D-glucanase neg1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=neg1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02055 Glyco_hydro_30	1e+02	13.3	Glycosyl hydrolase family 30 TIM-barrel domain
2	PF02057 Glyco_hydro_59	8.8e-114	391.3	Glycosyl hydrolase family 59
3	PF17387 Glyco_hydro_59M	8.3e-44	159.8	Glycosyl hydrolase family 59 central domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261304

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216124	0.965	Arylsulfatase A
2	9606.ENSP00000340409	0.960	Sphingomyelin phosphodiesterase
3	9606.ENSP00000385735	0.956	Galactosylceramide sulfotransferase
4	9606.ENSP00000218516	0.955	Galactosidase alpha
5	9606.ENSP00000314508	0.954	Glucosylceramidase that catalyzes, within the lysosomal compartment, the hydrolysis of glucosylceramide/GlcCer into free ceramide and glucose . Thereby, plays a central role in the degradation of complex lipids and the turnover of cellular membranes . Through the production of ceramides, participates to the PKC-activated salvage pathway of ceramide formation . Also plays a role in cholesterol metabolism . May either catalyze the glucosylation of cholesterol, through a transglucosylation reaction that transfers glucose from glucosylceramide to cholesterol . The short chain saturated C8: [...]
6	9606.ENSP00000371152	0.953	Acid ceramidase
7	9606.ENSP00000307126	0.944	Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2
8	9606.ENSP00000354829	0.943	Phosphatidylcholine:ceramide cholinephosphotransferase 1
9	9606.ENSP00000367343	0.941	Non-lysosomal glucosylceramidase
10	9606.ENSP00000271688	0.937	Ceramide synthase 2
11	9606.ENSP00000363397	0.936	Ceramide glucosyltransferase
12	9606.ENSP00000315137	0.934	Sphingosine-1-phosphate phosphatase 2
13	9606.ENSP00000342609	0.932	Alkaline ceramidase 2
14	9606.ENSP00000247225	0.931	Sphingosine-1-phosphate phosphatase 1
15	9606.ENSP00000378897	0.931	Neutral ceramidase
16	9606.ENSP00000376453	0.930	Ceramide synthase 6
17	9606.ENSP00000216264	0.929	Ceramide kinase
18	9606.ENSP00000386531	0.929	Sphingomyelin phosphodiesterase 4
19	9606.ENSP00000284382	0.926	Ceramide synthase 3
20	9606.ENSP00000378176	0.922	Phosphatidylcholine:ceramide cholinephosphotransferase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004336	1.000	galactosylceramidase activity
GO:0005488	0.542	binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0044238	0.986	primary metabolic process
GO:0006672	0.982	ceramide metabolic process
GO:0030149	0.956	sphingolipid catabolic process
GO:0006687	0.945	glycosphingolipid metabolic process
GO:1901136	0.757	carbohydrate derivative catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005764	1.000	lysosome
GO:0070013	0.991	intracellular organelle lumen
GO:0012505	0.934	endomembrane system
GO:0016020	0.915	membrane
GO:0005775	0.496	vacuolar lumen
GO:0043202	0.411	lysosomal lumen
GO:0031090	0.405	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14297	1.000	a beta-D-galactosyl-(1<->1')-N-acylsphing-4-enine + H2O = an N-acylsphing-4-enine + D-galactose
EC:3.2.1.46	1.000	galactosylceramidase.

[back to server]