StarFunc result for job id P54819

User Input

>input (239 residues)
MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSEL
GKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKE
KLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNE
KALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P29410	0.945	0.945	1.232E-42	239	0.929	0.929	P29410.pdb.gz	KAD2_RAT Adenylate kinase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ak2 PE=2 SV=2
2	AFDB:Q1L8L9	0.938	0.931	1.126E-39	241	0.782	0.776	Q1L8L9.pdb.gz	KAD2_DANRE Adenylate kinase 2, mitochondrial OS=Danio rerio OX=7955 GN=ak2 PE=2 SV=1
3	AFDB:I1XB05	0.942	0.931	4.456E-37	242	0.674	0.665	I1XB05.pdb.gz	I1XB05_HELAM Adenylate kinase OS=Helicoverpa armigera OX=29058 GN=AK2 PE=2 SV=1
4	PDB:2c9yA	0.685	0.743	2.747E-35	218	0.912	1.000	2c9yA.pdb.gz	Structure of Human Adenylate Kinase 2
5	AFDB:Q9U915	0.909	0.905	3.304E-35	240	0.636	0.633	Q9U915.pdb.gz	KAD2_DROME Adenylate kinase OS=Drosophila melanogaster OX=7227 GN=Adk2 PE=1 SV=1
6	AFDB:P34346	0.897	0.854	1.987E-34	251	0.598	0.570	P34346.pdb.gz	KAD2_CAEEL Adenylate kinase OS=Caenorhabditis elegans OX=6239 GN=let-754 PE=3 SV=2
7	AFDB:P33075	0.892	0.968	6.190E-32	220	0.531	0.577	P33075.pdb.gz	KAD2_SCHPO Adenylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=adk1 PE=1 SV=1
8	AFDB:Q5B2V8	0.882	0.815	3.112E-31	259	0.544	0.502	Q5B2V8.pdb.gz	KAD2_EMENI Adenylate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=adk1 PE=3 SV=1
9	AFDB:O82514	0.879	0.854	3.507E-31	246	0.473	0.459	O82514.pdb.gz	KAD4_ARATH Adenylate kinase 4 OS=Arabidopsis thaliana OX=3702 GN=ADK1 PE=1 SV=2
10	AFDB:P07170	0.890	0.957	6.007E-31	222	0.527	0.568	P07170.pdb.gz	KAD2_YEAST Adenylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADK1 PE=1 SV=2
11	AFDB:Q9FK35	0.883	0.851	2.239E-30	248	0.473	0.456	Q9FK35.pdb.gz	KAD3_ARATH Adenylate kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ADK2 PE=1 SV=1
12	PDB:3tlxB	0.871	0.867	4.704E-29	240	0.444	0.442	3tlxB.pdb.gz	Crystal Structure of PF10_0086, adenylate kinase from plasmodium falciparum
13	PDB:1dvrA	0.763	0.824	2.829E-26	220	0.519	0.564	1dvrA.pdb.gz	Structure of a mutant adenylate kinase ligated with an ATP-analogue showing domain closure over ATP.
14	PDB:1akeA	0.807	0.898	9.933E-24	214	0.439	0.491	1akeA.pdb.gz	Structure of the complex between adenylate kinase from Escherichia coli and the inhibitor Ap5A refined at 1.9 A resolution. A model for a catalytic transition state.
15	PDB:6zjbD	0.807	0.880	1.054E-21	218	0.372	0.408	6zjbD.pdb.gz	Structural Basis for GTP versus ATP Selectivity in the NMP Kinase AK3.
16	PDB:2cdnA	0.739	0.943	4.564E-18	186	0.314	0.403	2cdnA.pdb.gz	The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.
17	PDB:2ar7A	0.572	0.610	9.930E-18	221	0.356	0.385	2ar7A.pdb.gz
18	PDB:2c95A	0.675	0.822	3.486E-15	195	0.285	0.349	2c95A.pdb.gz	Structure of Adenylate Kinase 1 in Complex with P1, P4-Di(Adenosine)Tetraphosphate
19	PDB:3ndpB	0.557	0.634	6.340E-15	206	0.331	0.383	3ndpB.pdb.gz
20	PDB:1ukyA	0.701	0.847	5.796E-14	196	0.234	0.286	1ukyA.pdb.gz	Substrate specificity and assembly of the catalytic center derived from two structures of ligated uridylate kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P54819	2.35e-178	490	239	1.000	1.000	KAD2_HUMAN Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 PE=1 SV=2
2	Q9WTP6	9.70e-170	469	239	0.950	0.950	KAD2_MOUSE Adenylate kinase 2, mitochondrial OS=Mus musculus OX=10090 GN=Ak2 PE=1 SV=5
3	P29410	5.69e-166	459	239	0.929	0.929	KAD2_RAT Adenylate kinase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ak2 PE=2 SV=2
4	Q1L8L9	8.75e-141	395	241	0.770	0.763	KAD2_DANRE Adenylate kinase 2, mitochondrial OS=Danio rerio OX=7955 GN=ak2 PE=2 SV=1
5	I1XB05	1.54e-117	337	242	0.686	0.678	I1XB05_HELAM Adenylate kinase OS=Helicoverpa armigera OX=29058 GN=AK2 PE=2 SV=1
6	Q9U915	1.03e-109	317	240	0.644	0.642	KAD2_DROME Adenylate kinase OS=Drosophila melanogaster OX=7227 GN=Adk2 PE=1 SV=1
7	P34346	2.74e-103	301	251	0.607	0.578	KAD2_CAEEL Adenylate kinase OS=Caenorhabditis elegans OX=6239 GN=let-754 PE=3 SV=2
8	Q5B2V8	4.64e-96	283	259	0.569	0.525	KAD2_EMENI Adenylate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=adk1 PE=3 SV=1
9	P33075	3.34e-93	274	220	0.536	0.582	KAD2_SCHPO Adenylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=adk1 PE=1 SV=1
10	P07170	5.29e-91	269	222	0.527	0.568	KAD2_YEAST Adenylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADK1 PE=1 SV=2
11	O82514	2.48e-83	250	246	0.473	0.459	KAD4_ARATH Adenylate kinase 4 OS=Arabidopsis thaliana OX=3702 GN=ADK1 PE=1 SV=2
12	Q08480	5.50e-83	249	243	0.477	0.469	KAD4_ORYSJ Adenylate kinase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=ADK-B PE=2 SV=1
13	Q08479	2.62e-82	248	241	0.477	0.473	KAD3_ORYSJ Adenylate kinase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=ADK-A PE=2 SV=1
14	Q9FK35	2.53e-79	240	248	0.460	0.444	KAD3_ARATH Adenylate kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ADK2 PE=1 SV=1
15	Q8IJV6	1.03e-76	233	242	0.439	0.434	KAD1_PLAF7 Adenylate kinase 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=AK1 PE=1 SV=1
16	Q38BZ2	2.56e-74	226	222	0.439	0.473	Q38BZ2_TRYB2 Adenylate kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5150 PE=3 SV=1
17	P69441	2.07e-67	209	214	0.423	0.472	KAD_ECOLI Adenylate kinase OS=Escherichia coli (strain K12) OX=83333 GN=adk PE=1 SV=1
18	F1R4S7	1.41e-56	181	225	0.372	0.396	F1R4S7_DANRE GTP:AMP phosphotransferase AK3, mitochondrial OS=Danio rerio OX=7955 GN=ak3l1 PE=1 SV=1
19	Q9UIJ7	2.94e-56	181	227	0.372	0.392	KAD3_HUMAN GTP:AMP phosphotransferase AK3, mitochondrial OS=Homo sapiens OX=9606 GN=AK3 PE=1 SV=4
20	Q9WTP7	6.22e-56	180	227	0.364	0.383	KAD3_MOUSE GTP:AMP phosphotransferase AK3, mitochondrial OS=Mus musculus OX=10090 GN=Ak3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13207 AAA_17	2e-18	78.5	AAA domain
2	PF13238 AAA_18	23	16.9	AAA domain
3	PF13521 AAA_28	4.1e+02	12.6	AAA domain
4	PF13671 AAA_33	0.053	25.1	AAA domain
5	PF00406 ADK	1.2e-57	205.7	Adenylate kinase
6	PF05191 ADK_lid	9.9e-14	62.3	Adenylate kinase, active site lid
7	PF02224 Cytidylate_kin	42	15.3	Cytidylate kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000016945

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000002300	0.991	Uncharacterized protein
2	60711.ENSCSAP00000015145	0.990	Adenine phosphoribosyltransferase
3	60711.ENSCSAP00000005297	0.960	Adenosine kinase
4	60711.ENSCSAP00000000608	0.953	Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides
5	60711.ENSCSAP00000008160	0.952	Ribonucleotide reductase M2 B (TP53 inducible)
6	60711.ENSCSAP00000003453	0.948	Ribonucleotide reductase M2
7	60711.ENSCSAP00000001176	0.921	Deoxycytidine kinase
8	60711.ENSCSAP00000018170	0.913	Belongs to the pyruvate kinase family.
9	60711.ENSCSAP00000012503	0.906	Ectonucleoside triphosphate diphosphohydrolase 2
10	60711.ENSCSAP00000003353	0.902	Thiamin pyrophosphokinase 1
11	60711.ENSCSAP00000006437	0.902	Nucleoside-triphosphatase, cancer-related
12	60711.ENSCSAP00000011879	0.902	Broad-specificity nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. May have a role in nuclear energy homeostasis. Has also ATPase activity. May be involved in regulation of Cajal body (CB) formation
13	60711.ENSCSAP00000010061	0.889	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Also displays broad nucleoside diphosphate kinase activity. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism
14	60711.ENSCSAP00000011452	0.889	Adenylate kinase 9
15	60711.ENSCSAP00000016621	0.886	Adenylate kinase 5
16	60711.ENSCSAP00000006761	0.876	Adenylate kinase 7
17	60711.ENSCSAP00000011069	0.845	Adenylate kinase 8
18	60711.ENSCSAP00000001822	0.820	Nucleoside diphosphate kinase
19	60711.ENSCSAP00000001821	0.817	NME/NM23 nucleoside diphosphate kinase 1
20	60711.ENSCSAP00000002443	0.815	Ectonucleoside triphosphate diphosphohydrolase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004017	1.000	adenylate kinase activity
GO:0005488	0.996	binding
GO:0005515	0.936	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0034641	0.995	cellular nitrogen compound metabolic process
GO:0006139	0.991	nucleobase-containing compound metabolic process
GO:0044281	0.989	small molecule metabolic process
GO:0055086	0.938	nucleobase-containing small molecule metabolic process
GO:1901564	0.535	organonitrogen compound metabolic process
GO:0006753	0.497	nucleoside phosphate metabolic process
GO:0009117	0.473	nucleotide metabolic process
GO:0009058	0.358	biosynthetic process
GO:1901576	0.351	organic substance biosynthetic process
GO:0050896	0.329	response to stimulus
GO:0044249	0.323	cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	0.998	intracellular organelle lumen
GO:0005739	0.996	mitochondrion
GO:0005576	0.976	extracellular region
GO:0031982	0.950	vesicle
GO:0005615	0.945	extracellular space
GO:0070062	0.941	extracellular exosome
GO:0031967	0.938	organelle envelope
GO:0005740	0.923	mitochondrial envelope
GO:0016020	0.885	membrane
GO:0005829	0.869	cytosol
GO:0031090	0.365	organelle membrane
GO:0031970	0.364	organelle envelope lumen
GO:0005758	0.354	mitochondrial intermembrane space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12973	1.000	AMP + ATP = 2 ADP
EC:2.7.4.3	1.000	adenylate kinase.

[back to server]