StarFunc result for job id P54826

User Input

>input (345 residues)
MVAALLGGGGEARGGTVPGAWLCLMALLQLLGSAPRGSGLAHGRRLICWQALLQCQGEPE
CSYAYNQYAEACAPVLAQHGGGDAPGAAAAAFPASAASFSSRWRCPSHCISALIQLNHTR
RGPALEDCDCAQDENCKSTKRAIEPCLPRTSGGGAGGPGAGGVMGCTEARRRCDRDSRCN
LALSRYLTYCGKVFNGLRCTDECRTVIEDMLAMPKAALLNDCVCDGLERPICESVKENMA
RLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAGGEQPLDDDDGVPHPPRPGSGA
AASGGRGDLPYGPGRRSSGGGGRLAPRGAWTPLASILLLLLGPLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P54826	1.000	1.000	3.806E-50	345	1.000	1.000	P54826.pdb.gz	GAS1_HUMAN Growth arrest-specific protein 1 OS=Homo sapiens OX=9606 GN=GAS1 PE=1 SV=2
2	AFDB:Q01721	0.577	0.580	3.491E-38	343	0.843	0.848	Q01721.pdb.gz	GAS1_MOUSE Growth arrest-specific protein 1 OS=Mus musculus OX=10090 GN=Gas1 PE=1 SV=2
3	PDB:7rhqG	0.293	0.577	3.412E-19	160	0.464	1.000	7rhqG.pdb.gz	Structural basis for catalyzed assembly of the Sonic hedgehog-Patched1 signaling complex.
4	PDB:6q2sC	0.193	0.315	1.880E-3	199	0.122	0.211	6q2sC.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
5	PDB:6q2nC	0.178	0.280	1.823E-1	200	0.099	0.170	6q2nC.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
6	PDB:6gl7C	0.182	0.208	3.150E-1	297	0.104	0.121	6gl7C.pdb.gz
7	AFDB:O42721	0.095	0.081	3.400E-1	462	0.128	0.095	O42721.pdb.gz	MP1_TALMA Cell wall mannoprotein 1 OS=Talaromyces marneffei OX=37727 GN=MP1 PE=1 SV=1
8	AFDB:Q961B0	0.141	0.057	3.947E-1	1067	0.116	0.037	Q961B0.pdb.gz	Q961B0_DROME LD24920p OS=Drosophila melanogaster OX=7227 GN=Apc2 PE=2 SV=1
9	AFDB:Q4G0F8	0.140	0.061	4.816E-1	1135	0.139	0.042	Q4G0F8.pdb.gz	UBN1_MOUSE Ubinuclein-1 OS=Mus musculus OX=10090 GN=Ubn1 PE=2 SV=1
10	AFDB:Q9NPG3	0.143	0.063	5.591E-1	1134	0.154	0.047	Q9NPG3.pdb.gz	UBN1_HUMAN Ubinuclein-1 OS=Homo sapiens OX=9606 GN=UBN1 PE=1 SV=2
11	AFDB:Q4GYM8	0.090	0.051	7.918E-1	791	0.116	0.051	Q4GYM8.pdb.gz	Q4GYM8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3450 PE=4 SV=1
12	AFDB:Q5TGM0	0.131	0.168	1.669	249	0.075	0.104	Q5TGM0.pdb.gz	Q5TGM0_HUMAN Vesicle trafficking 1 OS=Homo sapiens OX=9606 GN=VTA1 PE=1 SV=1
13	AFDB:Q4GYP6	0.069	0.033	1.844	911	0.107	0.041	Q4GYP6.pdb.gz	Q4GYP6_TRYB2 BRO1 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3270 PE=4 SV=1
14	AFDB:A0A1B0GUN0	0.094	0.067	2.036	527	0.099	0.065	A0A1B0GUN0.pdb.gz	A0A1B0GUN0_HUMAN Pleckstrin homology domain containing A7 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=1
15	PDB:3tlxB	0.093	0.115	2.301	240	0.029	0.042	3tlxB.pdb.gz	Crystal Structure of PF10_0086, adenylate kinase from plasmodium falciparum
16	PDB:5jxdA	0.085	0.132	2.672	186	0.046	0.086	5jxdA.pdb.gz	The Tnfaip8-PE complex is a novel upstream effector in the anti-autophagic action of insulin
17	PDB:6bcuA	0.097	0.028	2.672	2204	0.084	0.013	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
18	PDB:6kvgA	0.158	0.188	2.672	256	0.084	0.113	6kvgA.pdb.gz
19	PDB:3dbrG	0.104	0.085	3.101	508	0.070	0.047	3dbrG.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
20	PDB:7wtww	0.111	0.114	4.616	332	0.078	0.081	7wtww.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P54826	0.0	683	345	1.000	1.000	GAS1_HUMAN Growth arrest-specific protein 1 OS=Homo sapiens OX=9606 GN=GAS1 PE=1 SV=2
2	Q01721	1.19e-130	378	343	0.788	0.793	GAS1_MOUSE Growth arrest-specific protein 1 OS=Mus musculus OX=10090 GN=Gas1 PE=1 SV=2
3	Q09553	6.24e-04	43.1	228	0.075	0.114	GAS1_CAEEL Growth arrest-specific protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=phg-1 PE=2 SV=2
4	F7F1M3	2.6	32.3	402	0.084	0.072	F7F1M3_RAT GDNF family receptor alpha 3 OS=Rattus norvegicus OX=10116 GN=Gfra3 PE=3 SV=1
5	A8DZ29	3.1	32.3	1919	0.064	0.011	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
6	O61380	3.1	32.3	1666	0.064	0.013	O61380_DROME Eukaryotic translation initiation factor 4G1, isoform A OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=3
7	Q9R1M7	3.2	32.3	1135	0.070	0.021	NMD3A_RAT Glutamate receptor ionotropic, NMDA 3A OS=Rattus norvegicus OX=10116 GN=Grin3a PE=1 SV=1
8	G5E9E7	6.0	31.6	1692	0.052	0.011	G5E9E7_HUMAN Tight junction protein 1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=1
9	A0A287BK35	6.1	31.6	2337	0.058	0.009	A0A287BK35_PIG Collagen type VI alpha 5 chain OS=Sus scrofa OX=9823 GN=COL6A5 PE=1 SV=2
10	Q07157	6.1	31.6	1748	0.052	0.010	ZO1_HUMAN Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=3
11	G3V1L9	6.2	31.6	1861	0.052	0.010	G3V1L9_HUMAN Tight junction protein 1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=2
12	A0A087X0K9	6.3	31.6	1768	0.052	0.010	A0A087X0K9_HUMAN Tight junction protein 1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=2
13	A0A0G2K2P5	6.6	31.2	1765	0.052	0.010	ZO1_RAT Tight junction protein ZO-1 OS=Rattus norvegicus OX=10116 GN=Tjp1 PE=1 SV=1
14	F1M4A0	6.6	31.2	1725	0.052	0.010	F1M4A0_RAT Tight junction protein 1 OS=Rattus norvegicus OX=10116 GN=Tjp1 PE=1 SV=3
15	Q9W1N8	6.7	31.2	941	0.072	0.027	Q9W1N8_DROME LD45221p OS=Drosophila melanogaster OX=7227 GN=mi PE=2 SV=2
16	O97758	6.8	31.2	1769	0.052	0.010	ZO1_CANLF Tight junction protein ZO-1 OS=Canis lupus familiaris OX=9615 GN=TJP1 PE=1 SV=1
17	P39447	7.4	31.2	1745	0.052	0.010	ZO1_MOUSE Tight junction protein ZO-1 OS=Mus musculus OX=10090 GN=Tjp1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02351 GDNF	9.2e-05	34.5	GDNF/GAS1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298743

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297261	0.999	Sonic hedgehog protein
2	9606.ENSP00000332353	0.993	Protein patched homolog 1
3	9606.ENSP00000376458	0.974	Cell adhesion molecule-related/down-regulated by oncogenes
4	9606.ENSP00000418663	0.948	Brother of CDO
5	9606.ENSP00000249373	0.940	Smoothened homolog
6	9606.ENSP00000361266	0.903	Protein patched homolog 2
7	9606.ENSP00000263816	0.872	Low-density lipoprotein receptor-related protein 2
8	9606.ENSP00000295731	0.843	Indian hedgehog protein
9	9606.ENSP00000266991	0.842	Desert hedgehog protein
10	9606.ENSP00000401145	0.838	Growth arrest-specific protein 2
11	9606.ENSP00000390436	0.706	Zinc finger protein GLI2
12	9606.ENSP00000269141	0.692	Cadherin-2
13	9606.ENSP00000296575	0.664	Hedgehog-interacting protein
14	9606.ENSP00000228682	0.645	Zinc finger protein GLI1
15	9606.ENSP00000212015	0.601	NAD-dependent protein deacetylase sirtuin-1
16	9606.ENSP00000379258	0.599	Transcriptional activator GLI3
17	9606.ENSP00000347942	0.551	Proto-oncogene tyrosine-protein kinase receptor Ret
18	9606.ENSP00000429969	0.551	Signal peptide, CUB domain and EGF like domain containing 2
19	9606.ENSP00000484631	0.547	Peripheral myelin protein 22
20	9606.ENSP00000365514	0.540	Zinc finger protein ZIC 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0010605	0.979	negative regulation of macromolecule metabolic process
GO:0009987	0.967	cellular process
GO:0050896	0.963	response to stimulus
GO:0010468	0.962	regulation of gene expression
GO:0051171	0.961	regulation of nitrogen compound metabolic process
GO:0080090	0.960	regulation of primary metabolic process
GO:0048522	0.936	positive regulation of cellular process
GO:0048523	0.923	negative regulation of cellular process
GO:0051172	0.861	negative regulation of nitrogen compound metabolic process
GO:0048856	0.800	anatomical structure development
GO:0032501	0.777	multicellular organismal process
GO:0010941	0.776	regulation of cell death
GO:0032879	0.774	regulation of localization
GO:0051246	0.745	regulation of protein metabolic process
GO:0009966	0.687	regulation of signal transduction
GO:0051716	0.673	cellular response to stimulus
GO:0007275	0.669	multicellular organism development
GO:0051726	0.665	regulation of cell cycle
GO:0007154	0.654	cell communication
GO:0023052	0.651	signaling
GO:0071363	0.649	cellular response to growth factor stimulus
GO:0007165	0.608	signal transduction
GO:1903317	0.605	regulation of protein maturation
GO:0035924	0.564	cellular response to vascular endothelial growth factor stimulus
GO:0043067	0.556	regulation of programmed cell death
GO:0048731	0.531	system development
GO:0030162	0.467	regulation of proteolysis
GO:0060341	0.402	regulation of cellular localization
GO:0009893	0.396	positive regulation of metabolic process
GO:0051049	0.363	regulation of transport
GO:0031323	0.350	regulation of cellular metabolic process
GO:0010629	0.350	negative regulation of gene expression
GO:0042981	0.331	regulation of apoptotic process
GO:0051248	0.330	negative regulation of protein metabolic process
GO:0060548	0.324	negative regulation of cell death
GO:0045786	0.319	negative regulation of cell cycle
GO:0007346	0.310	regulation of mitotic cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.506	membrane-bounded organelle
GO:0043229	0.503	intracellular organelle
GO:0043231	0.467	intracellular membrane-bounded organelle
GO:0005576	0.321	extracellular region
GO:0005737	0.321	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]