StarFunc result for job id P54851

User Input

>input (167 residues)
MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST
LQAVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRR
EDIHDKNAKFYPVTREGSYGYSYILAWVAFACTFISGMMYLILRKRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P54851	1.000	1.000	3.824E-27	167	1.000	1.000	P54851.pdb.gz	EMP2_HUMAN Epithelial membrane protein 2 OS=Homo sapiens OX=9606 GN=EMP2 PE=1 SV=1
2	AFDB:O88662	0.990	0.961	1.040E-21	172	0.778	0.756	O88662.pdb.gz	EMP2_MOUSE Epithelial membrane protein 2 OS=Mus musculus OX=10090 GN=Emp2 PE=1 SV=1
3	AFDB:F1QIK8	0.895	0.927	2.408E-16	161	0.581	0.602	F1QIK8.pdb.gz	EMP2_DANRE Epithelial membrane protein 2 OS=Danio rerio OX=7955 GN=emp2 PE=2 SV=2
4	AFDB:P16646	0.869	0.900	6.608E-14	161	0.443	0.460	P16646.pdb.gz	PMP22_MOUSE Peripheral myelin protein 22 OS=Mus musculus OX=10090 GN=Pmp22 PE=1 SV=2
5	AFDB:Q01453	0.880	0.917	8.634E-14	160	0.437	0.456	Q01453.pdb.gz	PMP22_HUMAN Peripheral myelin protein 22 OS=Homo sapiens OX=9606 GN=PMP22 PE=1 SV=1
6	AFDB:P54852	0.858	0.878	1.247E-11	163	0.383	0.393	P54852.pdb.gz	EMP3_HUMAN Epithelial membrane protein 3 OS=Homo sapiens OX=9606 GN=EMP3 PE=1 SV=1
7	AFDB:P54849	0.816	0.866	2.370E-11	157	0.383	0.408	P54849.pdb.gz	EMP1_HUMAN Epithelial membrane protein 1 OS=Homo sapiens OX=9606 GN=EMP1 PE=1 SV=3
8	AFDB:P54848	0.856	0.892	9.022E-11	160	0.359	0.375	P54848.pdb.gz	EMP1_RAT Epithelial membrane protein 1 OS=Rattus norvegicus OX=10116 GN=Emp1 PE=2 SV=1
9	AFDB:Q8NHS1	0.741	0.741	3.057E-7	167	0.180	0.180	Q8NHS1.pdb.gz	CLDN2_HUMAN Claudin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CLDND2 PE=1 SV=1
10	AFDB:P54825	0.743	0.720	1.604E-6	173	0.240	0.231	P54825.pdb.gz	LMIP_RAT Lens fiber membrane intrinsic protein OS=Rattus norvegicus OX=10116 GN=Lim2 PE=1 SV=1
11	PDB:7ocaI	0.689	0.628	2.032E-5	185	0.192	0.173	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
12	PDB:7rz4A	0.682	0.129	4.072E-5	993	0.186	0.031	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
13	PDB:5b2gC	0.687	0.353	6.590E-5	350	0.162	0.077	5b2gC.pdb.gz
14	PDB:6jp5E	0.584	0.578	6.590E-5	169	0.210	0.207	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
15	PDB:7rzaA	0.561	0.122	1.470E-4	981	0.162	0.028	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
16	PDB:6ov2A	0.685	0.633	1.636E-4	182	0.162	0.148	6ov2A.pdb.gz
17	PDB:5kbtA	0.699	0.141	2.945E-4	973	0.174	0.030	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
18	PDB:5weoA	0.667	0.130	6.569E-4	988	0.162	0.027	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
19	PDB:6c14B	0.669	0.680	2.783E-3	164	0.132	0.134	6c14B.pdb.gz
20	PDB:6wxuB	0.522	0.340	1.625E-2	273	0.102	0.062	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P54851	3.71e-122	342	167	1.000	1.000	EMP2_HUMAN Epithelial membrane protein 2 OS=Homo sapiens OX=9606 GN=EMP2 PE=1 SV=1
2	O88662	4.81e-94	271	172	0.778	0.756	EMP2_MOUSE Epithelial membrane protein 2 OS=Mus musculus OX=10090 GN=Emp2 PE=1 SV=1
3	Q66HH2	2.36e-93	270	172	0.766	0.744	EMP2_RAT Epithelial membrane protein 2 OS=Rattus norvegicus OX=10116 GN=Emp2 PE=2 SV=1
4	F1QIK8	6.95e-60	185	161	0.593	0.615	EMP2_DANRE Epithelial membrane protein 2 OS=Danio rerio OX=7955 GN=emp2 PE=2 SV=2
5	P25094	2.11e-36	125	160	0.413	0.431	PMP22_RAT Peripheral myelin protein 22 OS=Rattus norvegicus OX=10116 GN=Pmp22 PE=1 SV=1
6	P16646	2.94e-36	125	161	0.419	0.435	PMP22_MOUSE Peripheral myelin protein 22 OS=Mus musculus OX=10090 GN=Pmp22 PE=1 SV=2
7	P54849	5.96e-33	116	157	0.413	0.439	EMP1_HUMAN Epithelial membrane protein 1 OS=Homo sapiens OX=9606 GN=EMP1 PE=1 SV=3
8	Q01453	1.06e-32	115	160	0.377	0.394	PMP22_HUMAN Peripheral myelin protein 22 OS=Homo sapiens OX=9606 GN=PMP22 PE=1 SV=1
9	P54852	3.01e-29	107	163	0.359	0.368	EMP3_HUMAN Epithelial membrane protein 3 OS=Homo sapiens OX=9606 GN=EMP3 PE=1 SV=1
10	P54848	2.02e-26	100	160	0.371	0.388	EMP1_RAT Epithelial membrane protein 1 OS=Rattus norvegicus OX=10116 GN=Emp1 PE=2 SV=1
11	A0A2R8QM21	4.29e-04	41.6	221	0.257	0.195	A0A2R8QM21_DANRE Claudin OS=Danio rerio OX=7955 GN=cldn10l1b PE=3 SV=1
12	O95832	0.001	40.4	211	0.263	0.209	CLD1_HUMAN Claudin-1 OS=Homo sapiens OX=9606 GN=CLDN1 PE=1 SV=1
13	O88551	0.002	39.3	211	0.204	0.161	CLD1_MOUSE Claudin-1 OS=Mus musculus OX=10090 GN=Cldn1 PE=1 SV=1
14	P54825	0.004	38.5	173	0.246	0.237	LMIP_RAT Lens fiber membrane intrinsic protein OS=Rattus norvegicus OX=10116 GN=Lim2 PE=1 SV=1
15	P56563	0.004	38.5	173	0.246	0.237	LMIP_MOUSE Lens fiber membrane intrinsic protein OS=Mus musculus OX=10090 GN=Lim2 PE=1 SV=2
16	P56745	0.008	37.7	211	0.204	0.161	CLD1_RAT Claudin-1 OS=Rattus norvegicus OX=10116 GN=Cldn1 PE=1 SV=2
17	Q9Z0S6	0.008	37.7	231	0.210	0.152	CLD10_MOUSE Claudin-10 OS=Mus musculus OX=10090 GN=Cldn10 PE=1 SV=2
18	Q9YH92	0.055	35.4	215	0.198	0.153	CLD7B_DANRE Claudin-7-B OS=Danio rerio OX=7955 GN=cldn7b PE=2 SV=1
19	A0A1D8PH98	0.069	35.4	554	0.246	0.074	ITR1_CANAL Myo-inositol transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ITR1 PE=1 SV=1
20	A0A8I5Y8A8	0.15	34.3	252	0.186	0.123	A0A8I5Y8A8_RAT Claudin 18 OS=Rattus norvegicus OX=10116 GN=Cldn18 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07695 7TMR-DISM_7TM	10	17.5	7TM diverse intracellular signalling
2	PF07344 Amastin	17	16.7	Amastin surface glycoprotein
3	PF13903 Claudin_2	4.6e-08	44.6	PMP-22/EMP/MP20/Claudin tight junction
4	PF06653 Claudin_3	19	16.7	Tight junction protein, Claudin-like
5	PF07062 Clc-like	1.2e+02	13.6	Clc-like
6	PF03547 Mem_trans	16	15.4	Membrane transport protein
7	PF00822 PMP22_Claudin	2.1e-52	188.9	PMP-22/EMP/MP20/Claudin family
8	PF06687 SUR7	5.5	18.1	SUR7/PalI family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352540

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000459533	0.764	Lipopolysaccharide-induced tumor necrosis factor-alpha factor
2	9606.ENSP00000321627	0.671	Ankyrin repeat and fibronectin type III domain containing 1
3	9606.ENSP00000292778	0.669	Carbohydrate deacetylase
4	9606.ENSP00000379350	0.642	Integrin beta-1
5	9606.ENSP00000299721	0.632	Complexin-4
6	9606.ENSP00000347834	0.631	F-box/LRR-repeat protein 3
7	9606.ENSP00000369604	0.630	F-box only protein 16
8	9606.ENSP00000369981	0.623	Endophilin-A1
9	9606.ENSP00000263753	0.577	Shugoshin 1
10	9606.ENSP00000338235	0.556	Protein LYRIC
11	9606.ENSP00000392500	0.551	Neuroligin-1
12	9606.ENSP00000367743	0.530	Tetraspanin-7
13	9606.ENSP00000468002	0.514	KN motif and ankyrin repeat domain-containing protein 2
14	9606.ENSP00000361769	0.511	Regulating synaptic membrane exocytosis protein 3
15	9606.ENSP00000334314	0.506	Echinoderm microtubule-associated protein-like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005178	0.998	integrin binding
GO:0019900	0.892	kinase binding
GO:0019901	0.859	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050789	0.989	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0048584	0.952	positive regulation of response to stimulus
GO:0032501	0.936	multicellular organismal process
GO:0032502	0.935	developmental process
GO:0048856	0.934	anatomical structure development
GO:0010810	0.920	regulation of cell-substrate adhesion
GO:0007275	0.914	multicellular organism development
GO:0001952	0.902	regulation of cell-matrix adhesion
GO:0051239	0.900	regulation of multicellular organismal process
GO:0071840	0.887	cellular component organization or biogenesis
GO:0010646	0.887	regulation of cell communication
GO:0023051	0.853	regulation of signaling
GO:0016043	0.844	cellular component organization
GO:0048522	0.837	positive regulation of cellular process
GO:0019222	0.813	regulation of metabolic process
GO:0050793	0.800	regulation of developmental process
GO:0048870	0.795	cell motility
GO:0030030	0.786	cell projection organization
GO:0051179	0.780	localization
GO:0060255	0.777	regulation of macromolecule metabolic process
GO:0044057	0.756	regulation of system process
GO:0031323	0.751	regulation of cellular metabolic process
GO:0022607	0.719	cellular component assembly
GO:0044703	0.694	multi-organism reproductive process
GO:0051174	0.672	regulation of phosphorus metabolic process
GO:0051171	0.657	regulation of nitrogen compound metabolic process
GO:0023056	0.632	positive regulation of signaling
GO:0010647	0.630	positive regulation of cell communication
GO:0044706	0.613	multi-multicellular organism process
GO:0030031	0.606	cell projection assembly
GO:0080090	0.604	regulation of primary metabolic process
GO:0009966	0.598	regulation of signal transduction
GO:0016477	0.595	cell migration
GO:0098801	0.589	regulation of renal system process
GO:0051641	0.560	cellular localization
GO:2000026	0.556	regulation of multicellular organismal development
GO:0022603	0.549	regulation of anatomical structure morphogenesis
GO:0003008	0.534	system process
GO:0050896	0.523	response to stimulus
GO:0007565	0.520	female pregnancy
GO:0008104	0.462	protein localization
GO:0007155	0.455	cell adhesion
GO:0009967	0.450	positive regulation of signal transduction
GO:0120036	0.430	plasma membrane bounded cell projection organization
GO:0045765	0.427	regulation of angiogenesis
GO:0065008	0.412	regulation of biological quality
GO:0051246	0.405	regulation of protein metabolic process
GO:0048519	0.400	negative regulation of biological process
GO:0034394	0.370	protein localization to cell surface
GO:0007566	0.351	embryo implantation
GO:0019220	0.349	regulation of phosphate metabolic process
GO:0065009	0.339	regulation of molecular function
GO:0042325	0.335	regulation of phosphorylation
GO:0120031	0.330	plasma membrane bounded cell projection assembly
GO:0050878	0.323	regulation of body fluid levels
GO:0048523	0.315	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.992	endomembrane system
GO:0098857	0.938	membrane microdomain
GO:0005634	0.707	nucleus
GO:0045121	0.681	membrane raft
GO:0005794	0.679	Golgi apparatus
GO:0031982	0.529	vesicle
GO:0031981	0.336	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]