StarFunc result for job id P54868

User Input

>input (508 residues)
MQRLLTPVKRILQLTRAVQETSLTPARLLPVAHQRFSTASAVPLAKTDTWPKDVGILALE
VYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERIQLP
WDSVGRLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWM
ESSSWDGRYAMVVCGDIAVYPSGNARPTGGAGAVAMLIGPKAPLALERGLRGTHMENVYD
FYKPNLASEYPIVDGKLSIQCYLRALDRCYTSYRKKIQNQWKQAGSDRPFTLDDLQYMIF
HTPFCKMVQKSLARLMFNDFLSASSDTQTSLYKGLEAFGGLKLEDTYTNKDLDKALLKAS
QDMFDKKTKASLYLSTHNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFSYGSGLAASF
FSFRVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPG
DTNSLFPGTWYLERVDEQHRRKYARRPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VJL2	0.958	0.958	8.689E-103	508	1.000	1.000	A0A140VJL2.pdb.gz	A0A140VJL2_HUMAN Hydroxymethylglutaryl-CoA synthase OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:P22791	0.907	0.907	2.648E-97	508	0.892	0.892	P22791.pdb.gz	HMCS2_RAT Hydroxymethylglutaryl-CoA synthase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hmgcs2 PE=1 SV=2
3	PDB:2wyaA	0.903	0.997	1.675E-92	460	0.902	0.996	2wyaA.pdb.gz	Crystal Structures of Human Hmg-Coa Synthase Isoforms Provide Insights Into Inherited Ketogenesis Disorders and Inhibitor Design.
4	AFDB:A0A0R4IQG1	0.897	0.878	9.395E-81	519	0.610	0.597	A0A0R4IQG1.pdb.gz	A0A0R4IQG1_DANRE Hydroxymethylglutaryl-CoA synthase OS=Danio rerio OX=7955 GN=zgc:56481 PE=1 SV=1
5	AFDB:P17425	0.900	0.879	1.396E-80	520	0.612	0.598	P17425.pdb.gz	HMCS1_RAT Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Hmgcs1 PE=1 SV=1
6	AFDB:P54874	0.845	0.958	1.893E-61	447	0.433	0.492	P54874.pdb.gz	ERG13_SCHPO Hydroxymethylglutaryl-CoA synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hcs1 PE=1 SV=1
7	AFDB:P54873	0.861	0.947	7.510E-60	461	0.419	0.462	P54873.pdb.gz	HMCS_ARATH Hydroxymethylglutaryl-CoA synthase OS=Arabidopsis thaliana OX=3702 GN=HMGS PE=1 SV=2
8	AFDB:Q6FS22	0.844	0.929	9.599E-59	461	0.429	0.473	Q6FS22.pdb.gz	Q6FS22_CANGA Hydroxymethylglutaryl-CoA synthase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ERG13 PE=3 SV=1
9	AFDB:P54839	0.850	0.879	3.336E-58	491	0.407	0.422	P54839.pdb.gz	ERG13_YEAST Hydroxymethylglutaryl-CoA synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERG13 PE=1 SV=1
10	AFDB:A0A1D8PTW6	0.820	0.921	6.219E-58	451	0.415	0.468	A0A1D8PTW6.pdb.gz	ERG13_CANAL Hydroxymethylglutaryl-CoA synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ERG13 PE=1 SV=1
11	PDB:7cqtD	0.854	0.959	2.907E-57	451	0.417	0.470	7cqtD.pdb.gz	Overexpression and Inhibition of 3-Hydroxy-3-Methylglutaryl-CoA Synthase Affect Central Metabolic Pathways in Tobacco.
12	PDB:2f9aA	0.768	0.962	1.090E-49	404	0.398	0.500	2f9aA.pdb.gz	Structural basis for the design of potent and species-specific inhibitors of 3-hydroxy-3-methylglutaryl CoA synthases.
13	AFDB:Q57YL2	0.742	0.754	2.339E-29	499	0.187	0.190	Q57YL2.pdb.gz	Q57YL2_TRYB2 Hydroxymethylglutaryl-CoA synthase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.640 PE=3 SV=1
14	PDB:3h77B	0.521	0.754	8.567E-15	338	0.130	0.195	3h77B.pdb.gz	Structure of PqsD, a Pseudomonas quinolone signal biosynthetic enzyme, in complex with anthranilate.
15	PDB:8d1uA	0.504	0.777	8.567E-15	318	0.114	0.182	8d1uA.pdb.gz	Structures of chloramphenicol acetyltransferase III and Escherichia coli beta-ketoacylsynthase III co-crystallized with partially hydrolysed acetyl-oxa(dethia)CoA.
16	PDB:6eszA	0.490	0.680	3.335E-14	355	0.126	0.180	6eszA.pdb.gz
17	PDB:2d3mA	0.480	0.589	7.095E-13	405	0.126	0.158	2d3mA.pdb.gz	Structural Insight into Chain-Length Control and Product Specificity of Pentaketide Chromone Synthase from Aloe arborescens
18	PDB:2qnxA	0.506	0.739	7.095E-13	334	0.118	0.180	2qnxA.pdb.gz	Separate Entrance and Exit Portals for Ligand Traffic in Mycobacterium tuberculosis FabH
19	PDB:7cbfA	0.489	0.634	1.756E-12	383	0.114	0.151	7cbfA.pdb.gz
20	PDB:3ov2C	0.500	0.632	3.273E-12	392	0.120	0.156	3ov2C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IQG1	0.0	680	519	0.612	0.599	A0A0R4IQG1_DANRE Hydroxymethylglutaryl-CoA synthase OS=Danio rerio OX=7955 GN=zgc:56481 PE=1 SV=1
2	A0A140VJL2	0.0	1062	508	1.000	1.000	A0A140VJL2_HUMAN Hydroxymethylglutaryl-CoA synthase OS=Homo sapiens OX=9606 PE=2 SV=1
3	P17425	0.0	692	520	0.616	0.602	HMCS1_RAT Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Hmgcs1 PE=1 SV=1
4	P22791	0.0	966	508	0.892	0.892	HMCS2_RAT Hydroxymethylglutaryl-CoA synthase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hmgcs2 PE=1 SV=2
5	P54868	0.0	1062	508	1.000	1.000	HMCS2_HUMAN Hydroxymethylglutaryl-CoA synthase, mitochondrial OS=Homo sapiens OX=9606 GN=HMGCS2 PE=1 SV=1
6	P54869	0.0	963	508	0.894	0.894	HMCS2_MOUSE Hydroxymethylglutaryl-CoA synthase, mitochondrial OS=Mus musculus OX=10090 GN=Hmgcs2 PE=1 SV=2
7	Q01581	0.0	690	520	0.620	0.606	HMCS1_HUMAN Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCS1 PE=1 SV=2
8	P54874	5.06e-152	443	447	0.431	0.490	ERG13_SCHPO Hydroxymethylglutaryl-CoA synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hcs1 PE=1 SV=1
9	Q9M6U3	5.14e-152	444	461	0.423	0.466	Q9M6U3_BRAJU Hydroxymethylglutaryl-CoA synthase OS=Brassica juncea OX=3707 GN=HMGS1 PE=1 SV=1
10	P54873	2.96e-151	442	461	0.419	0.462	HMCS_ARATH Hydroxymethylglutaryl-CoA synthase OS=Arabidopsis thaliana OX=3702 GN=HMGS PE=1 SV=2
11	Q6FS22	1.91e-147	432	461	0.427	0.471	Q6FS22_CANGA Hydroxymethylglutaryl-CoA synthase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ERG13 PE=3 SV=1
12	A0A1D8PTW6	1.49e-142	419	451	0.411	0.463	ERG13_CANAL Hydroxymethylglutaryl-CoA synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ERG13 PE=1 SV=1
13	P54839	2.31e-141	417	491	0.409	0.424	ERG13_YEAST Hydroxymethylglutaryl-CoA synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERG13 PE=1 SV=1
14	Q57YL2	7.58e-13	72.8	499	0.203	0.206	Q57YL2_TRYB2 Hydroxymethylglutaryl-CoA synthase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.640 PE=3 SV=1
15	Q8Z9U1	1.8	33.5	399	0.037	0.048	FABV_YERPE Enoyl-[acyl-carrier-protein] reductase [NADH] OS=Yersinia pestis OX=632 GN=fabV PE=1 SV=1
16	Q6FRK3	5.5	32.3	791	0.049	0.032	Q6FRK3_CANGA Candida glabrata strain CBS138 chromosome H complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0H07887g PE=3 SV=1
17	Q8I5K3	7.1	32.0	2329	0.030	0.006	Q8I5K3_PLAF7 Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1221000 PE=4 SV=1
18	P07857	9.9	31.2	543	0.065	0.061	SCP2_BOVIN Sterol carrier protein 2 OS=Bos taurus OX=9913 GN=SCP2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08545 ACP_syn_III	1.6e+02	13.5	3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III
2	PF08540 HMG_CoA_synt_C	2.8e-128	439.0	Hydroxymethylglutaryl-coenzyme A synthase C terminal
3	PF01154 HMG_CoA_synt_N	1.4e-103	355.7	Hydroxymethylglutaryl-coenzyme A synthase N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358414

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287936	0.988	3-hydroxy-3-methylglutaryl-coenzyme A reductase
2	9606.ENSP00000265838	0.984	Acetyl-CoA acetyltransferase, mitochondrial
3	9606.ENSP00000385523	0.982	Peroxisome proliferator-activated receptor alpha
4	9606.ENSP00000356015	0.978	Acetyl-CoA acetyltransferase, cytosolic
5	9606.ENSP00000325136	0.972	hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
6	9606.ENSP00000363614	0.972	Hydroxymethylglutaryl-CoA lyase, mitochondrial
7	9606.ENSP00000285093	0.968	3-ketoacyl-CoA thiolase, mitochondrial
8	9606.ENSP00000333664	0.965	3-ketoacyl-CoA thiolase, peroxisomal
9	9606.ENSP00000196371	0.964	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial
10	9606.ENSP00000349078	0.964	Farnesyl pyrophosphate synthase
11	9606.ENSP00000231887	0.960	Peroxisomal bifunctional enzyme
12	9606.ENSP00000301012	0.949	Diphosphomevalonate decarboxylase
13	9606.ENSP00000324842	0.948	Acetoacetyl-CoA synthetase
14	9606.ENSP00000364883	0.936	Methylglutaconyl-CoA hydratase, mitochondrial
15	9606.ENSP00000381654	0.926	3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic
16	9606.ENSP00000361914	0.922	Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial
17	9606.ENSP00000325690	0.921	Histone-arginine methyltransferase CARM1
18	9606.ENSP00000262367	0.920	CREB-binding protein
19	9606.ENSP00000419692	0.920	Retinoic acid receptor RXR-alpha
20	9606.ENSP00000385216	0.909	Nuclear receptor coactivator 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004421	1.000	hydroxymethylglutaryl-CoA synthase activity
GO:0005488	0.997	binding
GO:0005515	0.991	protein binding
GO:0042802	0.894	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0009058	0.971	biosynthetic process
GO:0006629	0.957	lipid metabolic process
GO:1901576	0.954	organic substance biosynthetic process
GO:0008610	0.939	lipid biosynthetic process
GO:0044281	0.930	small molecule metabolic process
GO:0006807	0.807	nitrogen compound metabolic process
GO:1901564	0.772	organonitrogen compound metabolic process
GO:1901360	0.767	organic cyclic compound metabolic process
GO:0019693	0.760	ribose phosphate metabolic process
GO:0009117	0.706	nucleotide metabolic process
GO:0044283	0.697	small molecule biosynthetic process
GO:0072521	0.688	purine-containing compound metabolic process
GO:1901568	0.678	fatty acid derivative metabolic process
GO:0044249	0.655	cellular biosynthetic process
GO:0009150	0.625	purine ribonucleotide metabolic process
GO:0034032	0.336	purine nucleoside bisphosphate metabolic process
GO:0044255	0.330	cellular lipid metabolic process
GO:0033875	0.325	ribonucleoside bisphosphate metabolic process
GO:0032501	0.323	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.984	intracellular organelle lumen
GO:0005759	0.546	mitochondrial matrix
GO:0016020	0.379	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10188	1.000	acetoacetyl-CoA + acetyl-CoA + H2O = (3S)-hydroxy-3-methylglutaryl-CoA + CoA + H(+)
EC:2.3.3.10	1.000	hydroxymethylglutaryl-CoA synthase.

[back to server]