StarFunc result for job id P55008

User Input

>input (147 residues)
MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLN
GNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKM
ILMYEEKAREKEKPTGPPAKKAISELP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55008	1.000	1.000	3.444E-23	147	1.000	1.000	P55008.pdb.gz	AIF1_HUMAN Allograft inflammatory factor 1 OS=Homo sapiens OX=9606 GN=AIF1 PE=1 SV=1
2	AFDB:O70200	0.902	0.902	1.791E-20	147	0.891	0.891	O70200.pdb.gz	AIF1_MOUSE Allograft inflammatory factor 1 OS=Mus musculus OX=10090 GN=Aif1 PE=1 SV=1
3	AFDB:D3ZRD9	0.825	0.809	4.206E-16	150	0.653	0.640	D3ZRD9.pdb.gz	D3ZRD9_RAT Allograft inflammatory factor 1-like OS=Rattus norvegicus OX=10116 GN=Aif1l PE=4 SV=2
4	AFDB:Q9BQI0	0.822	0.807	2.187E-15	150	0.653	0.640	Q9BQI0.pdb.gz	AIF1L_HUMAN Allograft inflammatory factor 1-like OS=Homo sapiens OX=9606 GN=AIF1L PE=1 SV=1
5	PDB:2g2bA	0.696	0.683	2.791E-15	150	0.993	0.973	2g2bA.pdb.gz
6	PDB:2jjzC	0.725	0.918	1.372E-10	115	0.531	0.678	2jjzC.pdb.gz
7	PDB:2jjzD	0.488	0.852	6.940E-5	81	0.354	0.642	2jjzD.pdb.gz
8	AFDB:P25071	0.419	0.195	3.759E-4	324	0.156	0.071	P25071.pdb.gz	CML12_ARATH Calmodulin-like protein 12 OS=Arabidopsis thaliana OX=3702 GN=CML12 PE=1 SV=3
9	PDB:1ggzA	0.434	0.442	6.021E-4	144	0.177	0.181	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
10	AFDB:P54680	0.523	0.138	6.638E-4	610	0.163	0.039	P54680.pdb.gz	FIMB_DICDI Fimbrin OS=Dictyostelium discoideum OX=44689 GN=fimA PE=2 SV=2
11	PDB:5a2hA	0.427	0.427	6.747E-4	147	0.177	0.177	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
12	AFDB:O16305	0.424	0.419	7.026E-4	149	0.190	0.188	O16305.pdb.gz	CALM_CAEEL Calmodulin OS=Caenorhabditis elegans OX=6239 GN=cmd-1 PE=1 SV=3
13	AFDB:F4IVN6	0.466	0.382	8.333E-4	181	0.156	0.127	F4IVN6.pdb.gz	F4IVN6_ARATH Calmodulin 5 OS=Arabidopsis thaliana OX=3702 GN=CAM5 PE=1 SV=1
14	AFDB:J9VTH9	0.434	0.428	8.821E-4	149	0.136	0.134	J9VTH9.pdb.gz	J9VTH9_CRYNH Calmodulin OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_01557 PE=4 SV=2
15	AFDB:P24044	0.433	0.427	9.883E-4	149	0.177	0.174	P24044.pdb.gz	CALM_PLAFA Calmodulin OS=Plasmodium falciparum OX=5833 GN=CAM PE=1 SV=4
16	PDB:1osaA	0.411	0.409	1.191E-3	148	0.170	0.169	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
17	PDB:3qrxA	0.447	0.453	1.583E-3	145	0.197	0.200	3qrxA.pdb.gz	The structure, molecular dynamics, and energetics of centrin-melittin complex.
18	PDB:2f2pA	0.438	0.387	1.676E-3	169	0.150	0.130	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
19	PDB:5d43A	0.351	0.346	5.530E-3	150	0.156	0.153	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.
20	PDB:6hr1A	0.463	0.181	5.853E-3	406	0.156	0.057	6hr1A.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P55008	7.88e-103	292	147	1.000	1.000	AIF1_HUMAN Allograft inflammatory factor 1 OS=Homo sapiens OX=9606 GN=AIF1 PE=1 SV=1
2	O70200	3.69e-91	263	147	0.891	0.891	AIF1_MOUSE Allograft inflammatory factor 1 OS=Mus musculus OX=10090 GN=Aif1 PE=1 SV=1
3	P55009	4.08e-91	262	147	0.898	0.898	AIF1_RAT Allograft inflammatory factor 1 OS=Rattus norvegicus OX=10116 GN=Aif1 PE=2 SV=1
4	Q9BQI0	7.64e-64	194	150	0.639	0.627	AIF1L_HUMAN Allograft inflammatory factor 1-like OS=Homo sapiens OX=9606 GN=AIF1L PE=1 SV=1
5	D3ZRD9	1.17e-54	175	284	0.585	0.303	D3ZRD9_RAT Allograft inflammatory factor 1-like OS=Rattus norvegicus OX=10116 GN=Aif1l PE=4 SV=2
6	Q96C19	2.65e-07	50.1	240	0.163	0.100	EFHD2_HUMAN EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1
7	Q9D8Y0	3.29e-07	50.1	240	0.163	0.100	EFHD2_MOUSE EF-hand domain-containing protein D2 OS=Mus musculus OX=10090 GN=Efhd2 PE=1 SV=1
8	Q9VJ26	3.47e-07	49.7	217	0.170	0.115	EFHD2_DROME EF-hand domain-containing protein D2 homolog OS=Drosophila melanogaster OX=7227 GN=Swip-1 PE=2 SV=1
9	Q9D4J1	1.91e-06	47.8	240	0.163	0.100	EFHD1_MOUSE EF-hand domain-containing protein D1 OS=Mus musculus OX=10090 GN=Efhd1 PE=1 SV=1
10	Q9BUP0	2.41e-06	47.4	239	0.163	0.100	EFHD1_HUMAN EF-hand domain-containing protein D1 OS=Homo sapiens OX=9606 GN=EFHD1 PE=1 SV=1
11	P54680	4.56e-06	47.4	610	0.150	0.036	FIMB_DICDI Fimbrin OS=Dictyostelium discoideum OX=44689 GN=fimA PE=2 SV=2
12	Q9BRL5	5.78e-06	45.4	147	0.163	0.163	Q9BRL5_HUMAN CALM3 protein OS=Homo sapiens OX=9606 PE=1 SV=1
13	P25071	6.22e-06	46.6	324	0.150	0.068	CML12_ARATH Calmodulin-like protein 12 OS=Arabidopsis thaliana OX=3702 GN=CML12 PE=1 SV=3
14	G1NK53	6.36e-06	45.4	148	0.163	0.162	G1NK53_MELGA Calmodulin 1 OS=Meleagris gallopavo OX=9103 GN=CALM1 PE=4 SV=1
15	B4DJ51	6.51e-06	45.4	149	0.163	0.161	B4DJ51_HUMAN Calmodulin 1 (Phosphorylase kinase, delta), isoform CRA_a OS=Homo sapiens OX=9606 GN=HEL-S-72 PE=1 SV=1
16	P0DP23	6.51e-06	45.4	149	0.163	0.161	CALM1_HUMAN Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1
17	P0DP24	6.51e-06	45.4	149	0.163	0.161	CALM2_HUMAN Calmodulin-2 OS=Homo sapiens OX=9606 GN=CALM2 PE=1 SV=1
18	P0DP25	6.51e-06	45.4	149	0.163	0.161	CALM3_HUMAN Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1
19	P0DP26	6.51e-06	45.4	149	0.163	0.161	CALM1_MOUSE Calmodulin-1 OS=Mus musculus OX=10090 GN=Calm1 PE=1 SV=1
20	P0DP27	6.51e-06	45.4	149	0.163	0.161	CALM2_MOUSE Calmodulin-2 OS=Mus musculus OX=10090 GN=Calm2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	38	15.2	EF hand
2	PF13405 EF-hand_6	2	19.5	EF-hand domain
3	PF13499 EF-hand_7	0.094	24.5	EF-hand domain pair

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000007451

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000012211	0.738	Myosin, heavy chain 10, non-muscle
2	61853.ENSNLEP00000006282	0.697	Glial fibrillary acidic protein
3	61853.ENSNLEP00000000174	0.691	RNA binding protein, fox-1 homolog (C. elegans) 3
4	61853.ENSNLEP00000019764	0.666	Integrin, alpha M (complement component 3 receptor 3 subunit)
5	61853.ENSNLEP00000011725	0.643	CD68 molecule
6	61853.ENSNLEP00000002277	0.633	Multifunctional fusion protein
7	61853.ENSNLEP00000011546	0.621	SPEG complex locus
8	61853.ENSNLEP00000017376	0.611	annotation not available
9	61853.ENSNLEP00000004933	0.607	Myosin IG
10	61853.ENSNLEP00000011374	0.597	Myelin basic protein
11	61853.ENSNLEP00000008722	0.582	Microtubule-associated protein 2
12	61853.ENSNLEP00000002357	0.572	Myosin IF
13	61853.ENSNLEP00000006785	0.568	Chemokine (C-X3-C motif) receptor 1
14	61853.ENSNLEP00000014143	0.563	Myosin IE
15	61853.ENSNLEP00000004024	0.554	S100 calcium binding protein B
16	61853.ENSNLEP00000004302	0.554	Superoxide dismutase [Cu-Zn]
17	61853.ENSNLEP00000021949	0.546	Protein tyrosine phosphatase, receptor type, C
18	61853.ENSNLEP00000017684	0.540	Doublecortin
19	61853.ENSNLEP00000007426	0.535	Belongs to the tumor necrosis factor family.
20	61853.ENSNLEP00000006262	0.532	Myosin IIIB

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051015	1.000	actin filament binding
GO:0046872	0.784	metal ion binding
GO:0005509	0.484	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.996	response to stimulus
GO:0051716	0.993	cellular response to stimulus
GO:0048518	0.993	positive regulation of biological process
GO:0042221	0.987	response to chemical
GO:0048522	0.983	positive regulation of cellular process
GO:0042127	0.982	regulation of cell population proliferation
GO:0002376	0.981	immune system process
GO:0006950	0.977	response to stress
GO:0019222	0.973	regulation of metabolic process
GO:0009605	0.972	response to external stimulus
GO:0060255	0.957	regulation of macromolecule metabolic process
GO:0009893	0.946	positive regulation of metabolic process
GO:0034097	0.944	response to cytokine
GO:0006955	0.936	immune response
GO:2000145	0.935	regulation of cell motility
GO:0048519	0.934	negative regulation of biological process
GO:0006952	0.932	defense response
GO:0071310	0.931	cellular response to organic substance
GO:0051239	0.927	regulation of multicellular organismal process
GO:0010604	0.925	positive regulation of macromolecule metabolic process
GO:0010468	0.903	regulation of gene expression
GO:0034341	0.903	response to type II interferon
GO:0007154	0.900	cell communication
GO:0048583	0.900	regulation of response to stimulus
GO:0048523	0.900	negative regulation of cellular process
GO:0048660	0.893	regulation of smooth muscle cell proliferation
GO:0030335	0.869	positive regulation of cell migration
GO:0048584	0.867	positive regulation of response to stimulus
GO:0071345	0.866	cellular response to cytokine stimulus
GO:0051240	0.859	positive regulation of multicellular organismal process
GO:0002684	0.842	positive regulation of immune system process
GO:0071840	0.837	cellular component organization or biogenesis
GO:0008284	0.837	positive regulation of cell population proliferation
GO:0016043	0.832	cellular component organization
GO:0001819	0.828	positive regulation of cytokine production
GO:0023052	0.802	signaling
GO:0002694	0.799	regulation of leukocyte activation
GO:0002685	0.798	regulation of leukocyte migration
GO:0031323	0.779	regulation of cellular metabolic process
GO:0006996	0.774	organelle organization
GO:0030155	0.771	regulation of cell adhesion
GO:0051171	0.769	regulation of nitrogen compound metabolic process
GO:0032101	0.763	regulation of response to external stimulus
GO:0007165	0.717	signal transduction
GO:0032103	0.699	positive regulation of response to external stimulus
GO:0031326	0.699	regulation of cellular biosynthetic process
GO:0080090	0.694	regulation of primary metabolic process
GO:0002696	0.692	positive regulation of leukocyte activation
GO:0051249	0.671	regulation of lymphocyte activation
GO:0030029	0.668	actin filament-based process
GO:0070663	0.663	regulation of leukocyte proliferation
GO:0022407	0.660	regulation of cell-cell adhesion
GO:0022607	0.657	cellular component assembly
GO:0031325	0.657	positive regulation of cellular metabolic process
GO:0097435	0.649	supramolecular fiber organization
GO:0033993	0.636	response to lipid
GO:0030036	0.635	actin cytoskeleton organization
GO:0071346	0.628	cellular response to type II interferon
GO:0032944	0.626	regulation of mononuclear cell proliferation
GO:0051173	0.621	positive regulation of nitrogen compound metabolic process
GO:0051251	0.608	positive regulation of lymphocyte activation
GO:1903037	0.606	regulation of leukocyte cell-cell adhesion
GO:0061572	0.605	actin filament bundle organization
GO:0032502	0.603	developmental process
GO:0048661	0.603	positive regulation of smooth muscle cell proliferation
GO:0032501	0.585	multicellular organismal process
GO:0071675	0.585	regulation of mononuclear cell migration
GO:0048856	0.581	anatomical structure development
GO:0051017	0.578	actin filament bundle assembly
GO:0045785	0.577	positive regulation of cell adhesion
GO:0034599	0.565	cellular response to oxidative stress
GO:0050670	0.561	regulation of lymphocyte proliferation
GO:0050920	0.560	regulation of chemotaxis
GO:0050863	0.556	regulation of T cell activation
GO:0022409	0.556	positive regulation of cell-cell adhesion
GO:0008285	0.544	negative regulation of cell population proliferation
GO:1903039	0.544	positive regulation of leukocyte cell-cell adhesion
GO:0002688	0.538	regulation of leukocyte chemotaxis
GO:0014070	0.535	response to organic cyclic compound
GO:0014910	0.528	regulation of smooth muscle cell migration
GO:2000401	0.498	regulation of lymphocyte migration
GO:0043933	0.466	protein-containing complex organization
GO:0050870	0.440	positive regulation of T cell activation
GO:0065003	0.437	protein-containing complex assembly
GO:0023051	0.428	regulation of signaling
GO:0009966	0.416	regulation of signal transduction
GO:0014911	0.403	positive regulation of smooth muscle cell migration
GO:2000404	0.384	regulation of T cell migration
GO:0051726	0.374	regulation of cell cycle
GO:0048585	0.359	negative regulation of response to stimulus
GO:0051246	0.321	regulation of protein metabolic process
GO:0051179	0.320	localization
GO:1902806	0.318	regulation of cell cycle G1/S phase transition
GO:0008152	0.312	metabolic process
GO:0065009	0.302	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0043227	0.997	membrane-bounded organelle
GO:0005886	0.997	plasma membrane
GO:0043228	0.995	non-membrane-bounded organelle
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0031252	0.987	cell leading edge
GO:0005829	0.973	cytosol
GO:0005634	0.973	nucleus
GO:0005856	0.966	cytoskeleton
GO:0042995	0.959	cell projection
GO:0120025	0.935	plasma membrane bounded cell projection
GO:0099080	0.928	supramolecular complex
GO:0099081	0.912	supramolecular polymer
GO:0099512	0.894	supramolecular fiber
GO:0001726	0.883	ruffle
GO:0031256	0.882	leading edge membrane
GO:0031253	0.865	cell projection membrane
GO:0099513	0.843	polymeric cytoskeletal fiber
GO:0032587	0.832	ruffle membrane
GO:0005884	0.809	actin filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]