StarFunc result for job id P55010

User Input

>input (431 residues)
MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCE
LGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGN
SCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPP
PPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERV
NILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHF
LRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASK
KYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSD
NKDDDIDIDAI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R6Q1	0.531	0.531	7.749E-59	431	1.000	1.000	A0A024R6Q1.pdb.gz
2	AFDB:Q22918	0.488	0.484	1.357E-33	436	0.473	0.468	Q22918.pdb.gz	IF5_CAEEL Eukaryotic translation initiation factor 5 OS=Caenorhabditis elegans OX=6239 GN=C37C3.2 PE=3 SV=2
3	AFDB:Q09689	0.361	0.393	2.398E-30	395	0.374	0.408	Q09689.pdb.gz	IF5_SCHPO Probable eukaryotic translation initiation factor 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif5 PE=3 SV=1
4	AFDB:P38431	0.355	0.371	1.034E-27	405	0.360	0.383	P38431.pdb.gz	IF5_YEAST Eukaryotic translation initiation factor 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIF5 PE=1 SV=1
5	AFDB:Q9S825	0.342	0.337	7.517E-22	437	0.318	0.314	Q9S825.pdb.gz	IF5Z_ARATH Probable eukaryotic translation initiation factor 5-2 OS=Arabidopsis thaliana OX=3702 GN=At1g77840 PE=1 SV=1
6	AFDB:Q38BW8	0.329	0.370	2.028E-18	382	0.227	0.257	Q38BW8.pdb.gz	Q38BW8_TRYB2 Eukaryotic translation initiation factor 5, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4880 PE=3 SV=1
7	PDB:6fyxm	0.325	0.924	1.444E-14	147	0.197	0.578	6fyxm.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
8	AFDB:P09064	0.260	0.389	1.176E-7	285	0.067	0.102	P09064.pdb.gz	IF2B_YEAST Eukaryotic translation initiation factor 2 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUI3 PE=1 SV=2
9	PDB:2d74B	0.259	0.763	1.104E-6	137	0.077	0.241	2d74B.pdb.gz	Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.
10	AFDB:Q57Z81	0.230	0.312	1.798E-6	313	0.056	0.077	Q57Z81.pdb.gz	Q57Z81_TRYB2 Translation initiation factor, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.120 PE=3 SV=1
11	PDB:6fyxl	0.241	0.752	2.964E-6	128	0.067	0.227	6fyxl.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
12	PDB:7a094	0.245	0.670	9.164E-6	144	0.070	0.208	7a094.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
13	PDB:7f66J	0.275	0.206	6.935E-4	591	0.081	0.059	7f66J.pdb.gz
14	AFDB:A0JMC9	0.093	0.050	4.425E-2	947	0.107	0.049	A0JMC9.pdb.gz	A0JMC9_DANRE ADNP homeobox 2b OS=Danio rerio OX=7955 GN=si:ch211-129n15.3 PE=1 SV=1
15	AFDB:Q0II00	0.123	0.074	7.082E-2	902	0.111	0.053	Q0II00.pdb.gz	Q0II00_DANRE Nuclear factor NF-kappa-B p100 subunit OS=Danio rerio OX=7955 GN=p100 PE=1 SV=1
16	PDB:6swy8	0.086	0.107	2.052E-1	325	0.090	0.120	6swy8.pdb.gz
17	PDB:5iy7M	0.104	0.125	3.134E-1	310	0.107	0.148	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
18	PDB:7abi7	0.075	0.126	5.775E-1	236	0.051	0.093	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
19	PDB:7odrg	0.115	0.304	7.306E-1	134	0.032	0.104	7odrg.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
20	PDB:3zc0B	0.124	0.225	9.243E-1	191	0.072	0.162	3zc0B.pdb.gz	Structural Basis for Duplex RNA Recognition and Cleavage by Archaeoglobus Fulgidus C3Po.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P55010	0.0	886	431	1.000	1.000	IF5_HUMAN Eukaryotic translation initiation factor 5 OS=Homo sapiens OX=9606 GN=EIF5 PE=1 SV=2
2	P59325	0.0	855	429	0.972	0.977	IF5_MOUSE Eukaryotic translation initiation factor 5 OS=Mus musculus OX=10090 GN=Eif5 PE=1 SV=1
3	Q07205	0.0	855	429	0.970	0.974	IF5_RAT Eukaryotic translation initiation factor 5 OS=Rattus norvegicus OX=10116 GN=Eif5 PE=1 SV=1
4	H0YN40	1.67e-149	424	200	0.464	1.000	H0YN40_HUMAN Eukaryotic translation initiation factor 5 (Fragment) OS=Homo sapiens OX=9606 GN=EIF5 PE=1 SV=1
5	Q22918	2.26e-115	346	436	0.445	0.440	IF5_CAEEL Eukaryotic translation initiation factor 5 OS=Caenorhabditis elegans OX=6239 GN=C37C3.2 PE=3 SV=2
6	H0YLZ1	1.47e-107	315	146	0.339	1.000	H0YLZ1_HUMAN Eukaryotic translation initiation factor 5 (Fragment) OS=Homo sapiens OX=9606 GN=EIF5 PE=1 SV=1
7	Q09689	1.20e-91	284	395	0.374	0.408	IF5_SCHPO Probable eukaryotic translation initiation factor 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif5 PE=3 SV=1
8	P38431	8.38e-80	254	405	0.355	0.378	IF5_YEAST Eukaryotic translation initiation factor 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIF5 PE=1 SV=1
9	Q9S825	2.62e-56	194	437	0.309	0.304	IF5Z_ARATH Probable eukaryotic translation initiation factor 5-2 OS=Arabidopsis thaliana OX=3702 GN=At1g77840 PE=1 SV=1
10	Q38BW8	3.79e-31	125	382	0.158	0.178	Q38BW8_TRYB2 Eukaryotic translation initiation factor 5, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4880 PE=3 SV=1
11	Q8U3I5	5.93e-09	56.6	140	0.077	0.236	IF2B_PYRFU Translation initiation factor 2 subunit beta OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=eif2b PE=1 SV=1
12	P41375	7.04e-09	59.3	312	0.070	0.096	IF2B_DROME Eukaryotic translation initiation factor 2 subunit 2 OS=Drosophila melanogaster OX=7227 GN=eIF2beta PE=1 SV=1
13	P09064	2.19e-08	57.4	285	0.067	0.102	IF2B_YEAST Eukaryotic translation initiation factor 2 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUI3 PE=1 SV=2
14	Q99L45	1.39e-07	55.5	331	0.063	0.082	IF2B_MOUSE Eukaryotic translation initiation factor 2 subunit 2 OS=Mus musculus OX=10090 GN=Eif2s2 PE=1 SV=1
15	P56329	1.47e-07	55.1	321	0.060	0.081	IF2B_SCHPO Probable eukaryotic translation initiation factor 2 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif212 PE=1 SV=2
16	A0A8I6A6W5	1.67e-07	55.1	332	0.063	0.081	A0A8I6A6W5_RAT Eukaryotic translation initiation factor 2 subunit beta OS=Rattus norvegicus OX=10116 GN=Eif2s2 PE=1 SV=1
17	A0A8I6G5P0	1.77e-07	55.1	347	0.063	0.078	A0A8I6G5P0_RAT Eukaryotic translation initiation factor 2 subunit beta OS=Rattus norvegicus OX=10116 GN=Eif2s2 PE=1 SV=1
18	Q41969	1.88e-07	54.3	268	0.065	0.104	IF2B_ARATH Eukaryotic translation initiation factor 2 subunit beta OS=Arabidopsis thaliana OX=3702 GN=EIF2B PE=1 SV=3
19	P20042	2.07e-07	54.7	333	0.063	0.081	IF2B_HUMAN Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2
20	Q21230	1.69e-05	48.5	250	0.060	0.104	IF2B_CAEEL Eukaryotic translation initiation factor 2 subunit 2 OS=Caenorhabditis elegans OX=6239 GN=eif-2beta PE=3 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01873 eIF-5_eIF-2B	2.5e-39	145.2	Domain found in IF2B/IF5
2	PF02020 W2	3.8e-18	76.7	eIF4-gamma/eIF5/eIF2-epsilon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216554

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253039	0.999	Eukaryotic translation initiation factor 2 subunit 3
2	9606.ENSP00000256383	0.999	Eukaryotic translation initiation factor 2 subunit 1
3	9606.ENSP00000354125	0.999	Eukaryotic translation initiation factor 3 subunit B
4	9606.ENSP00000358140	0.999	Eukaryotic translation initiation factor 3 subunit A
5	9606.ENSP00000419449	0.999	Eukaryotic translation initiation factor 1
6	9606.ENSP00000253108	0.998	Eukaryotic translation initiation factor 3 subunit G
7	9606.ENSP00000364119	0.998	Eukaryotic translation initiation factor 2 subunit 2
8	9606.ENSP00000332604	0.997	Eukaryotic translation initiation factor 3 subunit C
9	9606.ENSP00000362688	0.996	Eukaryotic translation initiation factor 3 subunit I
10	9606.ENSP00000416255	0.992	Eukaryotic translation initiation factor 4 gamma 1
11	9606.ENSP00000296577	0.974	ATP-binding cassette sub-family E member 1
12	9606.ENSP00000289371	0.968	Eukaryotic translation initiation factor 5B
13	9606.ENSP00000368927	0.967	Eukaryotic translation initiation factor 1A, X-chromosomal
14	9606.ENSP00000370258	0.964	Eukaryotic translation initiation factor 3 subunit C-like protein
15	9606.ENSP00000261868	0.960	Eukaryotic translation initiation factor 3 subunit J
16	9606.ENSP00000216190	0.958	Eukaryotic translation initiation factor 3 subunit D
17	9606.ENSP00000388806	0.958	Eukaryotic translation initiation factor 4B
18	9606.ENSP00000273783	0.910	Translation initiation factor eIF-2B subunit epsilon
19	9606.ENSP00000472985	0.905	Ribosomal protein S5
20	9606.ENSP00000232905	0.904	Eukaryotic translation initiation factor 1b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031369	1.000	translation initiation factor binding
GO:0003743	1.000	translation initiation factor activity
GO:0030234	0.921	enzyme regulator activity
GO:0003723	0.918	RNA binding
GO:0050839	0.824	cell adhesion molecule binding
GO:0045296	0.753	cadherin binding
GO:0030695	0.574	GTPase regulator activity
GO:0140677	0.559	molecular function activator activity
GO:0005092	0.507	GDP-dissociation inhibitor activity
GO:0005096	0.507	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0006807	0.985	nitrogen compound metabolic process
GO:1901564	0.984	organonitrogen compound metabolic process
GO:0034641	0.983	cellular nitrogen compound metabolic process
GO:0044238	0.982	primary metabolic process
GO:0044249	0.975	cellular biosynthetic process
GO:0034248	0.975	regulation of amide metabolic process
GO:2000112	0.975	regulation of cellular macromolecule biosynthetic process
GO:0010467	0.971	gene expression
GO:0010608	0.971	post-transcriptional regulation of gene expression
GO:0019538	0.969	protein metabolic process
GO:0043603	0.968	amide metabolic process
GO:0006417	0.964	regulation of translation
GO:0002181	0.964	cytoplasmic translation
GO:0022613	0.922	ribonucleoprotein complex biogenesis
GO:0006413	0.913	translational initiation
GO:0006446	0.885	regulation of translational initiation
GO:0071826	0.871	ribonucleoprotein complex subunit organization
GO:0022607	0.844	cellular component assembly
GO:0022618	0.759	ribonucleoprotein complex assembly
GO:0065009	0.671	regulation of molecular function
GO:0050790	0.661	regulation of catalytic activity
GO:0044093	0.591	positive regulation of molecular function
GO:0043087	0.419	regulation of GTPase activity
GO:0002183	0.363	cytoplasmic translational initiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.999	membrane
GO:0071944	0.969	cell periphery
GO:0005886	0.961	plasma membrane
GO:0043226	0.728	organelle
GO:0043227	0.723	membrane-bounded organelle
GO:0043229	0.719	intracellular organelle
GO:0005634	0.681	nucleus
GO:0070013	0.593	intracellular organelle lumen
GO:0031981	0.570	nuclear lumen
GO:0032991	0.348	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]