StarFunc result for job id P55011

User Input

>input (1212 residues)
MEPRPTAPSSGAPGLAGVGETPSAAALAAARVELPGTAVPSVPEDAAPASRDGGGVRDEG
PAAAGDGLGRPLGPTPSQSRFQVDLVSENAGRAAAAAAAAAAAAAAAGAGAGAKQTPADG
EASGESEPAKGSEEAKGRFRVNFVDPAASSSAEDSLSDAAGVGVDGPNVSFQNGGDTVLS
EGSSLHSGGGGGSGHHQHYYYDTHTNTYYLRTFGHNTMDAVPRIDHYRHTAAQLGEKLLR
PSLAELHDELEKEPFEDGFANGEESTPTRDAVVTYTAESKGVVKFGWIKGVLVRCMLNIW
GVMLFIRLSWIVGQAGIGLSVLVIMMATVVTTITGLSTSAIATNGFVRGGGAYYLISRSL
GPEFGGAIGLIFAFANAVAVAMYVVGFAETVVELLKEHSILMIDEINDIRIIGAITVVIL
LGISVAGMEWEAKAQIVLLVILLLAIGDFVIGTFIPLESKKPKGFFGYKSEIFNENFGPD
FREEETFFSVFAIFFPAATGILAGANISGDLADPQSAIPKGTLLAILITTLVYVGIAVSV
GSCVVRDATGNVNDTIVTELTNCTSAACKLNFDFSSCESSPCSYGLMNNFQVMSMVSGFT
PLISAGIFSATLSSALASLVSAPKIFQALCKDNIYPAFQMFAKGYGKNNEPLRGYILTFL
IALGFILIAELNVIAPIISNFFLASYALINFSVFHASLAKSPGWRPAFKYYNMWISLLGA
ILCCIVMFVINWWAALLTYVIVLGLYIYVTYKKPDVNWGSSTQALTYLNALQHSIRLSGV
EDHVKNFRPQCLVMTGAPNSRPALLHLVHDFTKNVGLMICGHVHMGPRRQAMKEMSIDQA
KYQRWLIKNKMKAFYAPVHADDLREGAQYLMQAAGLGRMKPNTLVLGFKKDWLQADMRDV
DMYINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKS
DLDTSKPLSEKPITHKVEEEDGKTATQPLLKKESKGPIVPLNVADQKLLEASTQFQKKQG
KNTIDVWWLFDDGGLTLLIPYLLTTKKKWKDCKIRVFIGGKINRIDHDRRAMATLLSKFR
IDFSDIMVLGDINTKPKKENIIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELE
LYKTKTYRQIRLNELLKEHSSTANIIVMSLPVARKGAVSSALYMAWLEALSKDLPPILLV
RGNHQSVLTFYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55011	1.000	1.000	0.000	1212	1.000	1.000	P55011.pdb.gz	S12A2_HUMAN Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 PE=1 SV=1
2	PDB:7s1xB	0.652	0.894	1.246E-102	871	0.715	0.995	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
3	AFDB:Q1LX46	0.739	0.882	7.533E-97	1012	0.427	0.512	Q1LX46.pdb.gz	Q1LX46_DANRE Solute carrier family 12 member 3 OS=Danio rerio OX=7955 GN=si:ch211-122c9.4 PE=1 SV=1
4	AFDB:Q1L963	0.676	0.817	2.336E-82	998	0.384	0.467	Q1L963.pdb.gz	Q1L963_DANRE Solute carrier family 12 member 10, tandem duplicate 2 OS=Danio rerio OX=7955 GN=ncc2b PE=3 SV=1
5	AFDB:A0A0R4IYN4	0.512	0.898	4.895E-68	681	0.366	0.651	A0A0R4IYN4.pdb.gz
6	PDB:7d10A	0.358	0.956	1.189E-46	446	0.364	0.989	7d10A.pdb.gz
7	PDB:6y5rA	0.377	0.500	9.743E-44	879	0.217	0.299	6y5rA.pdb.gz
8	PDB:7airA	0.377	0.496	1.219E-42	885	0.215	0.294	7airA.pdb.gz	Phospho-regulation, nucleotide binding and ion access control in potassium-chloride cotransporters.
9	PDB:7d99A	0.382	0.498	4.311E-42	891	0.214	0.291	7d99A.pdb.gz	Structures and an activation mechanism of human potassium-chloride cotransporters.
10	PDB:6m1yA	0.383	0.480	3.340E-41	938	0.225	0.291	6m1yA.pdb.gz	Cryo-EM structures of the full-length human KCC2 and KCC3 cation-chloride cotransporters.
11	PDB:6m23A	0.378	0.478	2.285E-39	936	0.220	0.285	6m23A.pdb.gz	Cryo-EM structures of the full-length human KCC2 and KCC3 cation-chloride cotransporters.
12	PDB:7d14A	0.357	0.490	4.126E-35	850	0.212	0.302	7d14A.pdb.gz
13	PDB:7cmhB	0.285	0.684	2.981E-10	458	0.061	0.162	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
14	PDB:5j4nA	0.284	0.711	5.251E-10	437	0.064	0.176	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
15	AFDB:Q9VR07	0.232	0.285	5.001E-8	943	0.100	0.128	Q9VR07.pdb.gz	INE_DROME Sodium- and chloride-dependent GABA transporter ine OS=Drosophila melanogaster OX=7227 GN=ine PE=1 SV=1
16	AFDB:Q9W1J0	0.254	0.258	3.971E-3	1188	0.066	0.067	Q9W1J0.pdb.gz	Q9W1J0_DROME Transporter OS=Drosophila melanogaster OX=7227 GN=GlyT PE=3 SV=2
17	AFDB:Q9W517	0.070	0.058	2.617	1741	0.100	0.070	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KTI4	0.0	1651	1136	0.687	0.733	S12A2_DANRE Solute carrier family 12 member 2 OS=Danio rerio OX=7955 GN=slc12a2 PE=1 SV=3
2	A0A8I5ZP25	0.0	2126	1187	0.923	0.943	A0A8I5ZP25_RAT Solute carrier family 12 member 2 OS=Rattus norvegicus OX=10116 GN=Slc12a2 PE=1 SV=1
3	A9NJG3	0.0	1710	1147	0.711	0.752	A9NJG3_SALSA Na/K/2Cl co-transporter OS=Salmo salar OX=8030 GN=NKCC1a PE=2 SV=1
4	E9PTX9	0.0	2163	1203	0.935	0.942	E9PTX9_RAT Solute carrier family 12 member 2 OS=Rattus norvegicus OX=10116 GN=Slc12a2 PE=1 SV=1
5	M9PCA7	0.0	959	1191	0.433	0.441	M9PCA7_DROME Sodium chloride cotransporter 69, isoform C OS=Drosophila melanogaster OX=7227 GN=Ncc69 PE=1 SV=1
6	M9PI37	0.0	783	1207	0.341	0.342	M9PI37_DROME Sodium chloride cotransporter 69, isoform E OS=Drosophila melanogaster OX=7227 GN=Ncc69 PE=1 SV=1
7	P55011	0.0	2494	1212	1.000	1.000	S12A2_HUMAN Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 PE=1 SV=1
8	P55012	0.0	2130	1205	0.926	0.931	S12A2_MOUSE Solute carrier family 12 member 2 OS=Mus musculus OX=10090 GN=Slc12a2 PE=1 SV=2
9	P55013	0.0	1760	1191	0.732	0.745	S12A2_SQUAC Solute carrier family 12 member 2 OS=Squalus acanthias OX=7797 GN=SLC12A2 PE=1 SV=1
10	P55014	0.0	1367	1095	0.582	0.644	S12A1_MOUSE Solute carrier family 12 member 1 OS=Mus musculus OX=10090 GN=Slc12a1 PE=1 SV=2
11	P55016	0.0	1359	1095	0.575	0.637	S12A1_RAT Solute carrier family 12 member 1 OS=Rattus norvegicus OX=10116 GN=Slc12a1 PE=1 SV=1
12	P55017	0.0	1086	1021	0.443	0.526	S12A3_HUMAN Solute carrier family 12 member 3 OS=Homo sapiens OX=9606 GN=SLC12A3 PE=1 SV=3
13	P55018	0.0	1072	1002	0.441	0.534	S12A3_RAT Solute carrier family 12 member 3 OS=Rattus norvegicus OX=10116 GN=Slc12a3 PE=1 SV=2
14	P59158	0.0	1077	1002	0.442	0.535	S12A3_MOUSE Solute carrier family 12 member 3 OS=Mus musculus OX=10090 GN=Slc12a3 PE=1 SV=1
15	Q13621	0.0	1360	1099	0.581	0.641	S12A1_HUMAN Solute carrier family 12 member 1 OS=Homo sapiens OX=9606 GN=SLC12A1 PE=1 SV=2
16	Q1L963	0.0	907	998	0.394	0.478	Q1L963_DANRE Solute carrier family 12 member 10, tandem duplicate 2 OS=Danio rerio OX=7955 GN=ncc2b PE=3 SV=1
17	Q1LX46	0.0	1028	1012	0.431	0.516	Q1LX46_DANRE Solute carrier family 12 member 3 OS=Danio rerio OX=7955 GN=si:ch211-122c9.4 PE=1 SV=1
18	Q9QX10	0.0	2177	1203	0.932	0.938	Q9QX10_RAT Na-K-Cl cotransporter OS=Rattus norvegicus OX=10116 GN=Slc12a2 PE=2 SV=1
19	Q9VTW8	0.0	973	1171	0.436	0.451	Q9VTW8_DROME GH27027p OS=Drosophila melanogaster OX=7227 GN=Ncc69 PE=1 SV=1
20	A0A0B4LHE0	8.10e-95	330	1066	0.191	0.218	A0A0B4LHE0_DROME Kazachoc, isoform F OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00324 AA_permease	2.4e-149	509.7	Amino acid permease
2	PF13520 AA_permease_2	6.3e-15	66.6	Amino acid permease
3	PF08403 AA_permease_N	1.5e-22	90.2	Amino acid permease N-terminal
4	PF03522 SLC12	9.7e-161	547.1	Solute carrier family 12

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262461

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348278	0.984	STE20/SPS1-related proline-alanine-rich protein kinase
2	9606.ENSP00000356042	0.949	Ezrin
3	9606.ENSP00000155840	0.912	Potassium voltage-gated channel subfamily KQT member 1
4	9606.ENSP00000246914	0.906	Serine/threonine-protein kinase WNK4
5	9606.ENSP00000311713	0.893	Serine/threonine-protein kinase OSR1
6	9606.ENSP00000346667	0.889	Serine/threonine-protein kinase WNK3
7	9606.ENSP00000341292	0.887	Serine/threonine-protein kinase WNK1
8	9606.ENSP00000260600	0.826	Adenylate cyclase type 3
9	9606.ENSP00000294016	0.825	Adenylate cyclase type 9
10	9606.ENSP00000003084	0.822	Cystic fibrosis transmembrane conductance regulator
11	9606.ENSP00000365730	0.822	Serine/threonine-protein kinase 24
12	9606.ENSP00000419412	0.811	Anion exchange protein 2
13	9606.ENSP00000309591	0.800	cAMP-dependent protein kinase catalytic subunit alpha
14	9606.ENSP00000359719	0.800	cAMP-dependent protein kinase catalytic subunit beta
15	9606.ENSP00000366488	0.800	cAMP-dependent protein kinase catalytic subunit gamma
16	9606.ENSP00000355593	0.785	Disrupted in schizophrenia 1 protein
17	9606.ENSP00000297954	0.748	Serine/threonine-protein kinase WNK2
18	9606.ENSP00000329932	0.746	Galectin-9C
19	9606.ENSP00000291041	0.743	Serine/threonine-protein kinase H1
20	9606.ENSP00000393557	0.741	Electrogenic sodium bicarbonate cotransporter 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015379	1.000	potassium:chloride symporter activity
GO:0015378	1.000	sodium:chloride symporter activity
GO:0005515	0.997	protein binding
GO:0008511	0.987	sodium:potassium:chloride symporter activity
GO:0015267	0.944	channel activity
GO:0019899	0.833	enzyme binding
GO:0019900	0.800	kinase binding
GO:0019901	0.770	protein kinase binding
GO:0051087	0.742	chaperone binding
GO:0008519	0.738	ammonium transmembrane transporter activity
GO:0051879	0.704	Hsp90 protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051234	0.997	establishment of localization
GO:0006810	0.990	transport
GO:0009987	0.989	cellular process
GO:0006811	0.969	monoatomic ion transport
GO:0065007	0.967	biological regulation
GO:0006821	0.932	chloride transport
GO:0050896	0.887	response to stimulus
GO:0065008	0.872	regulation of biological quality
GO:0042592	0.865	homeostatic process
GO:0071840	0.776	cellular component organization or biogenesis
GO:0016043	0.763	cellular component organization
GO:0055085	0.700	transmembrane transport
GO:0019725	0.696	cellular homeostasis
GO:0030001	0.660	metal ion transport
GO:0098660	0.595	inorganic ion transmembrane transport
GO:0032501	0.581	multicellular organismal process
GO:0051716	0.573	cellular response to stimulus
GO:0050789	0.552	regulation of biological process
GO:0048878	0.524	chemical homeostasis
GO:0006813	0.474	potassium ion transport
GO:0050794	0.464	regulation of cellular process
GO:0007154	0.435	cell communication
GO:0042221	0.428	response to chemical
GO:0023052	0.411	signaling
GO:0006884	0.388	cell volume homeostasis
GO:0050801	0.331	monoatomic ion homeostasis
GO:0034220	0.321	monoatomic ion transmembrane transport
GO:0006814	0.319	sodium ion transport
GO:0098662	0.316	inorganic cation transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005886	0.992	plasma membrane
GO:0005737	0.991	cytoplasm
GO:0005829	0.983	cytosol
GO:0043227	0.701	membrane-bounded organelle
GO:0016324	0.583	apical plasma membrane
GO:0043229	0.467	intracellular organelle
GO:0009925	0.434	basal plasma membrane
GO:0030659	0.378	cytoplasmic vesicle membrane
GO:0043005	0.376	neuron projection
GO:0031253	0.367	cell projection membrane
GO:0043025	0.366	neuronal cell body
GO:0016328	0.366	lateral plasma membrane
GO:0044298	0.363	cell body membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	1.000	chloride(in) = chloride(out)
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)
RHEA:29463	1.000	K(+)(in) = K(+)(out)
RHEA:28747	0.738	NH4(+)(in) = NH4(+)(out)

[back to server]