StarFunc result for job id P55017

User Input

>input (1021 residues)
MAELPTTETPGDATLCSGRFTISTLLSSDEPSPPAAYDSSHPSHLTHSSTFCMRTFGYNT
IDVVPTYEHYANSTQPGEPRKVRPTLADLHSFLKQEGRHLHALAFDSRPSHEMTDGLVEG
EAGTSSEKNPEEPVRFGWVKGVMIRCMLNIWGVILYLRLPWITAQAGIVLTWIIILLSVT
VTSITGLSISAISTNGKVKSGGTYFLISRSLGPELGGSIGLIFAFANAVGVAMHTVGFAE
TVRDLLQEYGAPIVDPINDIRIIAVVSVTVLLAISLAGMEWESKAQVLFFLVIMVSFANY
LVGTLIPPSEDKASKGFFSYRADIFVQNLVPDWRGPDGTFFGMFSIFFPSATGILAGANI
SGDLKDPAIAIPKGTLMAIFWTTISYLAISATIGSCVVRDASGVLNDTVTPGWGACEGLA
CSYGWNFTECTQQHSCHYGLINYYQTMSMVSGFAPLITAGIFGATLSSALACLVSAAKVF
QCLCEDQLYPLIGFFGKGYGKNKEPVRGYLLAYAIAVAFIIIAELNTIAPIISNFFLCSY
ALINFSCFHASITNSPGWRPSFQYYNKWAALFGAIISVVIMFLLTWWAALIAIGVVLFLL
LYVIYKKPEVNWGSSVQAGSYNLALSYSVGLNEVEDHIKNYRPQCLVLTGPPNFRPALVD
FVGTFTRNLSLMICGHVLIGPHKQRMPELQLIANGHTKWLNKRKIKAFYSDVIAEDLRRG
VQILMQAAGLGRMKPNILVVGFKKNWQSAHPATVEDYIGILHDAFDFNYGVCVMRMREGL
NVSKMMQAHINPVFDPAEDGKEASARVDPKALVKEEQATTIFQSEQGKKTIDIYWLFDDG
GLTLLIPYLLGRKRRWSKCKIRVFVGGQINRMDQERKAIISLLSKFRLGFHEVHILPDIN
QNPRAEHTKRFEDMIAPFRLNDGFKDEATVNEMRRDCPWKISDEEITKNRVKSLRQVRLN
EIVLDYSRDAALIVITLPIGRKGKCPSSLYMAWLETLSQDLRPPVILIRGNQENVLTFYC
Q

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55011	0.872	0.737	0.000	1212	0.519	0.437	P55011.pdb.gz	S12A2_HUMAN Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 PE=1 SV=1
2	AFDB:P55017	1.000	1.000	0.000	1021	1.000	1.000	P55017.pdb.gz	S12A3_HUMAN Solute carrier family 12 member 3 OS=Homo sapiens OX=9606 GN=SLC12A3 PE=1 SV=3
3	AFDB:Q1LX46	0.895	0.903	0.000	1012	0.636	0.641	Q1LX46.pdb.gz	Q1LX46_DANRE Solute carrier family 12 member 3 OS=Danio rerio OX=7955 GN=si:ch211-122c9.4 PE=1 SV=1
4	AFDB:Q13621	0.879	0.818	1.805E-103	1099	0.527	0.490	Q13621.pdb.gz	S12A1_HUMAN Solute carrier family 12 member 1 OS=Homo sapiens OX=9606 GN=SLC12A1 PE=1 SV=2
5	AFDB:Q1L963	0.811	0.829	2.834E-94	998	0.513	0.525	Q1L963.pdb.gz	Q1L963_DANRE Solute carrier family 12 member 10, tandem duplicate 2 OS=Danio rerio OX=7955 GN=ncc2b PE=3 SV=1
6	PDB:7s1xB	0.756	0.879	1.137E-81	871	0.493	0.577	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
7	AFDB:A0A0R4IYN4	0.594	0.879	5.519E-63	681	0.357	0.535	A0A0R4IYN4.pdb.gz
8	AFDB:Q924N4	0.457	0.411	1.486E-50	1150	0.269	0.239	Q924N4.pdb.gz	S12A6_MOUSE Solute carrier family 12 member 6 OS=Mus musculus OX=10090 GN=Slc12a6 PE=1 SV=2
9	AFDB:Q5RK27	0.461	0.438	3.644E-50	1083	0.255	0.240	Q5RK27.pdb.gz	S12A7_RAT Solute carrier family 12 member 7 OS=Rattus norvegicus OX=10116 GN=Slc12a7 PE=2 SV=2
10	AFDB:H2KZC3	0.674	0.613	7.469E-50	1129	0.253	0.229	H2KZC3.pdb.gz	H2KZC3_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=2
11	AFDB:Q63633	0.459	0.417	8.051E-49	1139	0.267	0.240	Q63633.pdb.gz	S12A5_RAT Solute carrier family 12 member 5 OS=Rattus norvegicus OX=10116 GN=Slc12a5 PE=1 SV=2
12	PDB:6y5rA	0.433	0.495	5.517E-45	879	0.240	0.279	6y5rA.pdb.gz
13	PDB:7airA	0.435	0.495	6.220E-44	885	0.237	0.273	7airA.pdb.gz	Phospho-regulation, nucleotide binding and ion access control in potassium-chloride cotransporters.
14	PDB:7d99A	0.432	0.489	7.116E-44	891	0.235	0.269	7d99A.pdb.gz	Structures and an activation mechanism of human potassium-chloride cotransporters.
15	PDB:6m1yA	0.426	0.460	4.683E-43	938	0.244	0.265	6m1yA.pdb.gz	Cryo-EM structures of the full-length human KCC2 and KCC3 cation-chloride cotransporters.
16	PDB:6m23A	0.431	0.468	2.538E-41	936	0.240	0.262	6m23A.pdb.gz	Cryo-EM structures of the full-length human KCC2 and KCC3 cation-chloride cotransporters.
17	PDB:7d14A	0.419	0.494	3.426E-37	850	0.231	0.278	7d14A.pdb.gz
18	PDB:7d10A	0.421	0.949	5.366E-37	446	0.269	0.617	7d10A.pdb.gz
19	PDB:5j4nA	0.274	0.575	3.949E-10	437	0.076	0.178	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
20	PDB:7cmhB	0.331	0.671	1.387E-9	458	0.065	0.144	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KTI4	0.0	1025	1136	0.502	0.452	S12A2_DANRE Solute carrier family 12 member 2 OS=Danio rerio OX=7955 GN=slc12a2 PE=1 SV=3
2	A0A8I5ZP25	0.0	1077	1187	0.522	0.449	A0A8I5ZP25_RAT Solute carrier family 12 member 2 OS=Rattus norvegicus OX=10116 GN=Slc12a2 PE=1 SV=1
3	A9NJG3	0.0	1060	1147	0.524	0.466	A9NJG3_SALSA Na/K/2Cl co-transporter OS=Salmo salar OX=8030 GN=NKCC1a PE=2 SV=1
4	E9PTX9	0.0	1075	1203	0.525	0.446	E9PTX9_RAT Solute carrier family 12 member 2 OS=Rattus norvegicus OX=10116 GN=Slc12a2 PE=1 SV=1
5	M9PCA7	0.0	672	1191	0.345	0.296	M9PCA7_DROME Sodium chloride cotransporter 69, isoform C OS=Drosophila melanogaster OX=7227 GN=Ncc69 PE=1 SV=1
6	M9PI37	0.0	672	1207	0.345	0.292	M9PI37_DROME Sodium chloride cotransporter 69, isoform E OS=Drosophila melanogaster OX=7227 GN=Ncc69 PE=1 SV=1
7	P55011	0.0	1072	1212	0.523	0.441	S12A2_HUMAN Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 PE=1 SV=1
8	P55012	0.0	1072	1205	0.524	0.444	S12A2_MOUSE Solute carrier family 12 member 2 OS=Mus musculus OX=10090 GN=Slc12a2 PE=1 SV=2
9	P55013	0.0	1063	1191	0.522	0.448	S12A2_SQUAC Solute carrier family 12 member 2 OS=Squalus acanthias OX=7797 GN=SLC12A2 PE=1 SV=1
10	P55014	0.0	1053	1095	0.519	0.484	S12A1_MOUSE Solute carrier family 12 member 1 OS=Mus musculus OX=10090 GN=Slc12a1 PE=1 SV=2
11	P55016	0.0	1058	1095	0.522	0.487	S12A1_RAT Solute carrier family 12 member 1 OS=Rattus norvegicus OX=10116 GN=Slc12a1 PE=1 SV=1
12	P55017	0.0	2113	1021	1.000	1.000	S12A3_HUMAN Solute carrier family 12 member 3 OS=Homo sapiens OX=9606 GN=SLC12A3 PE=1 SV=3
13	P55018	0.0	1859	1002	0.895	0.912	S12A3_RAT Solute carrier family 12 member 3 OS=Rattus norvegicus OX=10116 GN=Slc12a3 PE=1 SV=2
14	P59158	0.0	1868	1002	0.898	0.915	S12A3_MOUSE Solute carrier family 12 member 3 OS=Mus musculus OX=10090 GN=Slc12a3 PE=1 SV=1
15	Q13621	0.0	1053	1099	0.523	0.486	S12A1_HUMAN Solute carrier family 12 member 1 OS=Homo sapiens OX=9606 GN=SLC12A1 PE=1 SV=2
16	Q1L963	0.0	1065	998	0.513	0.525	Q1L963_DANRE Solute carrier family 12 member 10, tandem duplicate 2 OS=Danio rerio OX=7955 GN=ncc2b PE=3 SV=1
17	Q1LX46	0.0	1337	1012	0.635	0.640	Q1LX46_DANRE Solute carrier family 12 member 3 OS=Danio rerio OX=7955 GN=si:ch211-122c9.4 PE=1 SV=1
18	Q9QX10	0.0	1090	1203	0.522	0.443	Q9QX10_RAT Na-K-Cl cotransporter OS=Rattus norvegicus OX=10116 GN=Slc12a2 PE=2 SV=1
19	Q9VTW8	0.0	672	1171	0.345	0.301	Q9VTW8_DROME GH27027p OS=Drosophila melanogaster OX=7227 GN=Ncc69 PE=1 SV=1
20	Q6Z0E2	8.59e-85	297	989	0.263	0.272	CCC1_ORYSJ Cation-chloride cotransporter 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CCC1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00324 AA_permease	3.7e-135	462.9	Amino acid permease
2	PF08403 AA_permease_N	4.1e-24	95.2	Amino acid permease N-terminal
3	PF09874 DUF2101	5e+02	11.8	Predicted membrane protein (DUF2101)
4	PF03522 SLC12	1.1e-129	444.8	Solute carrier family 12

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000402152

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246914	0.916	Serine/threonine-protein kinase WNK4
2	9606.ENSP00000364831	0.861	Chloride channel protein ClC-Kb
3	9606.ENSP00000348278	0.840	STE20/SPS1-related proline-alanine-rich protein kinase
4	9606.ENSP00000376432	0.832	ATP-sensitive inward rectifier potassium channel 1
5	9606.ENSP00000341292	0.823	Serine/threonine-protein kinase WNK1
6	9606.ENSP00000312397	0.816	Kelch-like protein 3
7	9606.ENSP00000346667	0.804	Serine/threonine-protein kinase WNK3
8	9606.ENSP00000354006	0.761	Transient receptor potential cation channel subfamily M member 6
9	9606.ENSP00000360312	0.730	Barttin
10	9606.ENSP00000264938	0.729	Sodium/hydrogen exchanger 3
11	9606.ENSP00000264734	0.726	Claudin-16
12	9606.ENSP00000199280	0.715	Aquaporin-2
13	9606.ENSP00000332771	0.693	Chloride channel protein ClC-Ka
14	9606.ENSP00000027335	0.692	Cadherin-17
15	9606.ENSP00000265715	0.689	Pendrin
16	9606.ENSP00000297954	0.685	Serine/threonine-protein kinase WNK2
17	9606.ENSP00000353292	0.682	Amiloride-sensitive sodium channel subunit alpha
18	9606.ENSP00000272190	0.672	Renin
19	9606.ENSP00000320239	0.666	Transient receptor potential cation channel subfamily M member 7
20	9606.ENSP00000311713	0.661	Serine/threonine-protein kinase OSR1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015378	1.000	sodium:chloride symporter activity
GO:0015379	0.999	potassium:chloride symporter activity
GO:0008511	0.428	sodium:potassium:chloride symporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051179	0.996	localization
GO:0006810	0.988	transport
GO:0006811	0.968	monoatomic ion transport
GO:0009987	0.906	cellular process
GO:0006812	0.622	monoatomic cation transport
GO:0030001	0.608	metal ion transport
GO:0032501	0.509	multicellular organismal process
GO:0055085	0.356	transmembrane transport
GO:0065007	0.317	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098590	0.998	plasma membrane region
GO:0043227	0.997	membrane-bounded organelle
GO:0045177	0.995	apical part of cell
GO:0016324	0.982	apical plasma membrane
GO:0031982	0.980	vesicle
GO:0005576	0.898	extracellular region
GO:0005622	0.890	intracellular anatomical structure
GO:0043230	0.833	extracellular organelle
GO:1903561	0.824	extracellular vesicle
GO:0070062	0.798	extracellular exosome
GO:0005737	0.674	cytoplasm
GO:0005829	0.396	cytosol
GO:0043229	0.392	intracellular organelle
GO:0043231	0.318	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	1.000	chloride(in) = chloride(out)
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)
RHEA:29463	0.999	K(+)(in) = K(+)(out)

[back to server]