StarFunc result for job id P55039

User Input

>input (364 residues)
MGILEKISEIEKEIARTQKNKATEYHLGLLKAKLAKYRAQLLEPSKSASSKGEGFDVMKS
GDARVALIGFPSVGKSTFLSLMTSTASEAASYEFTTLTCIPGVIEYKGANIQLLDLPGII
EGAAQGKGRGRQVIAVARTADVIIMMLDATKGEVQRSLLEKELESVGIRLNKHKPNIYFK
PKKGGGISFNSTVTLTQCSEKLVQLILHEYKIFNAEVLFREDCSPDEFIDVIVGNRVYMP
CLYVYNKIDQISMEEVDRLARKPNSVVISCGMKLNLDYLLEMLWEYLALTCIYTKKRGQR
PDFTDAIILRKGASVEHVCHRIHRSLASQFKYALVWGTSTKYSPQRVGLTHTMEHEDVIQ
IVKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55039	1.000	1.000	3.306E-78	364	1.000	1.000	P55039.pdb.gz	DRG2_HUMAN Developmentally-regulated GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=DRG2 PE=1 SV=1
2	AFDB:Q9CAI1	0.945	0.865	3.986E-58	399	0.643	0.586	Q9CAI1.pdb.gz	DRG2_ARATH Developmentally-regulated G-protein 2 OS=Arabidopsis thaliana OX=3702 GN=DRG2 PE=2 SV=1
3	AFDB:P32235	0.942	0.942	4.493E-58	364	0.662	0.662	P32235.pdb.gz	GTP1_SCHPO GTP-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gtp1 PE=3 SV=2
4	AFDB:P32233	0.935	0.928	3.873E-55	367	0.577	0.572	P32233.pdb.gz	DRG1_MOUSE Developmentally-regulated GTP-binding protein 1 OS=Mus musculus OX=10090 GN=Drg1 PE=1 SV=1
5	AFDB:Q9SVA6	0.932	0.920	5.223E-55	369	0.580	0.572	Q9SVA6.pdb.gz	DRG3_ARATH Developmentally-regulated G-protein 3 OS=Arabidopsis thaliana OX=3702 GN=DRG3 PE=1 SV=1
6	AFDB:Q38E85	0.935	0.911	1.533E-54	374	0.593	0.578	Q38E85.pdb.gz	Q38E85_TRYB2 Developmentally regulated GTP-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0720 PE=4 SV=1
7	AFDB:P32234	0.935	0.925	2.474E-54	368	0.588	0.582	P32234.pdb.gz	128UP_DROME GTP-binding protein 128up OS=Drosophila melanogaster OX=7227 GN=128up PE=2 SV=2
8	AFDB:P53295	0.950	0.940	2.626E-54	368	0.591	0.584	P53295.pdb.gz	RBG2_YEAST Ribosome-interacting GTPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RBG2 PE=1 SV=1
9	AFDB:Q38AS7	0.927	0.917	2.402E-53	368	0.555	0.549	Q38AS7.pdb.gz	Q38AS7_TRYB2 Developmentally regulated GTP-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3970 PE=4 SV=1
10	AFDB:Q9UT21	0.943	0.938	3.242E-51	366	0.519	0.516	Q9UT21.pdb.gz	YFY7_SCHPO Uncharacterized GTP-binding protein C9.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9.07c PE=2 SV=1
11	PDB:4a9aA	0.857	0.875	3.537E-44	356	0.538	0.551	4a9aA.pdb.gz
12	PDB:7nrcSo	0.827	0.865	4.928E-37	347	0.558	0.585	7nrcSo.pdb.gz	Structure of Gcn1 bound to stalled and colliding 80S ribosomes.
13	PDB:5ee3B	0.423	0.423	2.429E-9	364	0.154	0.154	5ee3B.pdb.gz	ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
14	PDB:1ni3A	0.480	0.464	1.297E-8	378	0.162	0.156	1ni3A.pdb.gz
15	PDB:2ohfA	0.428	0.471	1.914E-7	327	0.126	0.141	2ohfA.pdb.gz	Human OLA1 defines an ATPase subfamily in the Obg family of GTP-binding proteins
16	PDB:7po27	0.283	0.189	1.649E-6	571	0.157	0.100	7po27.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
17	PDB:7o9kG	0.337	0.361	2.361E-6	337	0.140	0.151	7o9kG.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
18	PDB:7bl29P1	0.283	0.303	4.293E-6	338	0.135	0.145	7bl29P1.pdb.gz	Snapshots of native pre-50S ribosomes reveal a biogenesis factor network and evolutionary specialization.
19	PDB:3j81k	0.279	0.278	6.147E-6	365	0.113	0.112	3j81k.pdb.gz	Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
20	PDB:5ady6	0.328	0.285	1.420E-5	426	0.135	0.115	5ady6.pdb.gz	Hflx is a Ribosome Splitting Factor Rescuing Stalled Ribosomes Under Stress Conditions

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MZF9	0.0	682	343	0.909	0.965	A8MZF9_HUMAN Developmentally regulated GTP binding protein 2 OS=Homo sapiens OX=9606 GN=DRG2 PE=1 SV=1
2	P55039	0.0	753	364	1.000	1.000	DRG2_HUMAN Developmentally-regulated GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=DRG2 PE=1 SV=1
3	Q9QXB9	0.0	748	364	0.986	0.986	DRG2_MOUSE Developmentally-regulated GTP-binding protein 2 OS=Mus musculus OX=10090 GN=Drg2 PE=1 SV=1
4	P32235	7.93e-178	499	364	0.662	0.662	GTP1_SCHPO GTP-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gtp1 PE=3 SV=2
5	Q9LQK0	5.68e-177	499	399	0.651	0.594	DRG1_ARATH Developmentally-regulated G-protein 1 OS=Arabidopsis thaliana OX=3702 GN=DRG1 PE=1 SV=1
6	Q9CAI1	1.05e-175	496	399	0.646	0.589	DRG2_ARATH Developmentally-regulated G-protein 2 OS=Arabidopsis thaliana OX=3702 GN=DRG2 PE=2 SV=1
7	Q38E85	6.15e-158	449	374	0.593	0.578	Q38E85_TRYB2 Developmentally regulated GTP-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0720 PE=4 SV=1
8	P53295	1.49e-153	438	368	0.593	0.587	RBG2_YEAST Ribosome-interacting GTPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RBG2 PE=1 SV=1
9	P32234	1.42e-148	426	368	0.585	0.579	128UP_DROME GTP-binding protein 128up OS=Drosophila melanogaster OX=7227 GN=128up PE=2 SV=2
10	Q9SVA6	3.06e-146	420	369	0.580	0.572	DRG3_ARATH Developmentally-regulated G-protein 3 OS=Arabidopsis thaliana OX=3702 GN=DRG3 PE=1 SV=1
11	P32233	1.09e-144	416	367	0.569	0.564	DRG1_MOUSE Developmentally-regulated GTP-binding protein 1 OS=Mus musculus OX=10090 GN=Drg1 PE=1 SV=1
12	P43690	1.43e-144	416	367	0.560	0.556	DRG1_XENLA Developmentally-regulated GTP-binding protein 1 OS=Xenopus laevis OX=8355 GN=drg1 PE=1 SV=1
13	Q38AS7	1.84e-144	415	368	0.555	0.549	Q38AS7_TRYB2 Developmentally regulated GTP-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3970 PE=4 SV=1
14	Q9Y295	4.49e-144	414	367	0.566	0.561	DRG1_HUMAN Developmentally-regulated GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=DRG1 PE=1 SV=1
15	P39729	9.02e-135	390	369	0.549	0.542	RBG1_YEAST Ribosome-interacting GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RBG1 PE=1 SV=1
16	Q9UT21	5.74e-134	389	366	0.522	0.519	YFY7_SCHPO Uncharacterized GTP-binding protein C9.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9.07c PE=2 SV=1
17	Q5A779	1.23e-128	375	368	0.527	0.522	Q5A779_CANAL GTP-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DRG1 PE=4 SV=1
18	A2AFK4	2.00e-10	63.9	405	0.102	0.091	A2AFK4_MOUSE Mitochondrial ribosome associated GTPase 2 OS=Mus musculus OX=10090 GN=Mtg2 PE=1 SV=1
19	Q8L7L0	2.73e-10	63.9	681	0.104	0.056	OBGC_ARATH GTP-binding protein OBGC, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OBGL PE=2 SV=1
20	Q9H4K7	3.36e-10	63.2	406	0.099	0.089	MTG2_HUMAN Mitochondrial ribosome-associated GTPase 2 OS=Homo sapiens OX=9606 GN=MTG2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00350 Dynamin_N	15	17.1	Dynamin family
2	PF02421 FeoB_N	1.1e-06	39.7	Ferrous iron transport protein B
3	PF01926 MMR_HSR1	3.3e-16	70.8	50S ribosome-binding GTPase
4	PF16897 MMR_HSR1_Xtn	1e-38	142.9	C-terminal region of MMR_HSR1 domain
5	PF02824 TGS	4.2e-21	86.1	TGS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 185453.XP_006875595.1

Rank	PPI partner	STRING score	Description
1	185453.XP_006839970.1	0.987	RWD domain-containing protein 1
2	185453.XP_006864126.1	0.961	Zinc finger CCCH domain-containing protein 15
3	185453.XP_006834488.1	0.931	RWD domain-containing protein 4-like
4	185453.XP_006865512.1	0.851	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 14 Proteins
5	185453.XP_006862036.1	0.839	Ribosome biogenesis protein WDR12
6	185453.XP_006868164.1	0.820	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: inserted 1 base in 1 codon
7	185453.XP_006874333.1	0.815	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins
8	185453.XP_006830855.1	0.761	60S ribosomal protein L8-like
9	185453.XP_006862209.1	0.751	tyrosine--tRNA ligase, cytoplasmic
10	185453.XP_006859610.1	0.737	T-complex protein 1 subunit beta
11	185453.XP_006876948.1	0.731	T-complex protein 1 subunit epsilon
12	185453.XP_006835420.1	0.706	E2F-associated phosphoprotein
13	185453.XP_006862942.1	0.690	T-complex protein 1 subunit eta isoform X1
14	185453.XP_006832388.1	0.686	Notchless protein homolog 1
15	185453.XP_006866361.1	0.686	Zinc finger CCHC domain-containing protein 4-like isoform X1
16	185453.XP_006865852.1	0.669	40S ribosomal protein S13
17	185453.XP_006867926.1	0.657	Cell differentiation protein RCD1 homolog
18	185453.XP_006839511.1	0.653	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins
19	185453.XP_006869892.1	0.653	Adenylate kinase isoenzyme 6-like
20	185453.XP_006871028.1	0.653	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 13 Proteins

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005525	1.000	GTP binding
GO:0003924	0.999	GTPase activity
GO:0005515	0.996	protein binding
GO:0003676	0.995	nucleic acid binding
GO:0003723	0.993	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.976	regulation of cellular process
GO:0050896	0.718	response to stimulus
GO:0051716	0.615	cellular response to stimulus
GO:0008152	0.585	metabolic process
GO:0071704	0.572	organic substance metabolic process
GO:0044238	0.545	primary metabolic process
GO:0007154	0.521	cell communication
GO:0006807	0.515	nitrogen compound metabolic process
GO:0023052	0.481	signaling
GO:0043170	0.447	macromolecule metabolic process
GO:0044237	0.437	cellular metabolic process
GO:1901564	0.398	organonitrogen compound metabolic process
GO:0048518	0.386	positive regulation of biological process
GO:0034641	0.385	cellular nitrogen compound metabolic process
GO:0019538	0.320	protein metabolic process
GO:0044260	0.306	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0005654	0.995	nucleoplasm
GO:0016020	0.958	membrane
GO:0032991	0.833	protein-containing complex
GO:0005739	0.582	mitochondrion
GO:0043232	0.311	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.999	GTP + H2O = GDP + H(+) + phosphate

[back to server]