StarFunc result for job id P55055

User Input

>input (460 residues)
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQ
SQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKR
SFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI
ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMR
RLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM
LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1D8P7	0.855	0.853	6.542E-59	461	1.000	0.998	F1D8P7.pdb.gz	F1D8P7_HUMAN Liver X nuclear receptor beta OS=Homo sapiens OX=9606 GN=NR1H2 PE=1 SV=1
2	AFDB:B4DXU5	0.532	0.541	1.433E-41	453	0.624	0.634	B4DXU5.pdb.gz	B4DXU5_HUMAN Nuclear receptor subfamily 1 group H member 3 OS=Homo sapiens OX=9606 GN=NR1H3 PE=1 SV=1
3	AFDB:Q62685	0.534	0.552	2.213E-41	445	0.615	0.636	Q62685.pdb.gz	NR1H3_RAT Oxysterols receptor LXR-alpha OS=Rattus norvegicus OX=10116 GN=Nr1h3 PE=1 SV=1
4	AFDB:Q8JHU1	0.528	0.594	2.633E-41	409	0.611	0.687	Q8JHU1.pdb.gz	Q8JHU1_CHICK Liver X receptor OS=Gallus gallus OX=9031 GN=LXR PE=1 SV=1
5	AFDB:A0A060WYW4	0.530	0.528	5.756E-41	462	0.641	0.639	A0A060WYW4.pdb.gz	A0A060WYW4_ONCMY Oxysterols receptor LXR-alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00014026001 PE=3 SV=1
6	AFDB:A0A0R4IVP0	0.530	0.552	7.471E-40	441	0.637	0.664	A0A0R4IVP0.pdb.gz	A0A0R4IVP0_DANRE Nuclear receptor subfamily 1, group H, member 3 OS=Danio rerio OX=7955 GN=im:7141239 PE=3 SV=1
7	AFDB:A0A2R8QR22	0.449	0.428	4.255E-26	483	0.352	0.335	A0A2R8QR22.pdb.gz
8	AFDB:O18473	0.480	0.386	8.528E-25	576	0.363	0.290	O18473.pdb.gz	ECR_HELVI Ecdysone receptor OS=Heliothis virescens OX=7102 GN=EcR PE=1 SV=1
9	AFDB:Q60641	0.456	0.431	2.218E-24	488	0.333	0.314	Q60641.pdb.gz	NR1H4_MOUSE Bile acid receptor OS=Mus musculus OX=10090 GN=Nr1h4 PE=1 SV=3
10	AFDB:P34021	0.494	0.263	5.524E-24	878	0.367	0.192	P34021.pdb.gz	ECR_DROME Ecdysone receptor OS=Drosophila melanogaster OX=7227 GN=EcR PE=1 SV=1
11	PDB:3dzyA	0.405	0.604	2.928E-14	302	0.191	0.291	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.459	0.863	4.932E-13	238	0.172	0.332	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.377	0.682	7.297E-8	246	0.126	0.236	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.365	0.618	1.341E-5	259	0.100	0.178	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:7r5jK0	0.102	0.056	2.933E-1	1086	0.098	0.041	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
16	PDB:4alyA	0.082	0.129	3.341E-1	211	0.061	0.133	4alyA.pdb.gz
17	PDB:3aqbD	0.121	0.158	3.807E-1	325	0.059	0.083	3aqbD.pdb.gz	Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
18	PDB:7qp9A	0.083	0.108	4.529E-1	327	0.065	0.092	7qp9A.pdb.gz	Structures and mechanism of the plant PIN-FORMED auxin transporter.
19	PDB:7p5jA	0.073	0.083	4.730E-1	399	0.070	0.080	7p5jA.pdb.gz
20	PDB:4k34A	0.083	0.096	7.304E-1	381	0.087	0.105	4k34A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060VSG9	0.0	553	425	0.626	0.678	A0A060VSG9_ONCMY Oxysterols receptor LXR-alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00064070001 PE=3 SV=1
2	A0A060WYW4	0.0	557	462	0.630	0.628	A0A060WYW4_ONCMY Oxysterols receptor LXR-alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00014026001 PE=3 SV=1
3	A0A0R4IVP0	0.0	566	441	0.609	0.635	A0A0R4IVP0_DANRE Nuclear receptor subfamily 1, group H, member 3 OS=Danio rerio OX=7955 GN=im:7141239 PE=3 SV=1
4	B4DXU5	0.0	551	453	0.617	0.627	B4DXU5_HUMAN Nuclear receptor subfamily 1 group H member 3 OS=Homo sapiens OX=9606 GN=NR1H3 PE=1 SV=1
5	B8Y3M1	0.0	555	462	0.628	0.626	B8Y3M1_ONCMY Liver X receptor OS=Oncorhynchus mykiss OX=8022 GN=LXR PE=2 SV=1
6	F1D8N1	0.0	551	447	0.617	0.635	F1D8N1_HUMAN Liver X nuclear receptor alpha variant 1 OS=Homo sapiens OX=9606 GN=NR1H3 PE=2 SV=1
7	F1D8P7	0.0	940	461	1.000	0.998	F1D8P7_HUMAN Liver X nuclear receptor beta OS=Homo sapiens OX=9606 GN=NR1H2 PE=1 SV=1
8	P55055	0.0	945	460	1.000	1.000	NR1H2_HUMAN Oxysterols receptor LXR-beta OS=Homo sapiens OX=9606 GN=NR1H2 PE=1 SV=2
9	Q13133	0.0	551	447	0.617	0.635	NR1H3_HUMAN Oxysterols receptor LXR-alpha OS=Homo sapiens OX=9606 GN=NR1H3 PE=1 SV=2
10	Q60644	0.0	774	446	0.870	0.897	NR1H2_MOUSE Oxysterols receptor LXR-beta OS=Mus musculus OX=10090 GN=Nr1h2 PE=1 SV=1
11	Q62685	0.0	557	445	0.604	0.625	NR1H3_RAT Oxysterols receptor LXR-alpha OS=Rattus norvegicus OX=10116 GN=Nr1h3 PE=1 SV=1
12	Q62755	0.0	757	446	0.876	0.904	NR1H2_RAT Oxysterols receptor LXR-beta OS=Rattus norvegicus OX=10116 GN=Nr1h2 PE=2 SV=1
13	Q8JHU1	0.0	547	409	0.598	0.672	Q8JHU1_CHICK Liver X receptor OS=Gallus gallus OX=9031 GN=LXR PE=1 SV=1
14	Q9Z0Y9	0.0	560	445	0.609	0.629	NR1H3_MOUSE Oxysterols receptor LXR-alpha OS=Mus musculus OX=10090 GN=Nr1h3 PE=1 SV=3
15	P34021	1.23e-86	285	878	0.354	0.186	ECR_DROME Ecdysone receptor OS=Drosophila melanogaster OX=7227 GN=EcR PE=1 SV=1
16	Q6DGW7	1.34e-86	275	483	0.339	0.323	Q6DGW7_DANRE Bile acid receptor OS=Danio rerio OX=7955 GN=zgc:92742 PE=2 SV=1
17	O18473	8.82e-82	265	576	0.359	0.286	ECR_HELVI Ecdysone receptor OS=Heliothis virescens OX=7102 GN=EcR PE=1 SV=1
18	Q62735	5.14e-77	249	469	0.304	0.299	NR1H4_RAT Bile acid receptor OS=Rattus norvegicus OX=10116 GN=Nr1h4 PE=1 SV=1
19	Q60641	1.35e-76	249	488	0.304	0.287	NR1H4_MOUSE Bile acid receptor OS=Mus musculus OX=10090 GN=Nr1h4 PE=1 SV=3
20	Q96RI1	1.24e-75	246	486	0.309	0.292	NR1H4_HUMAN Bile acid receptor OS=Homo sapiens OX=9606 GN=NR1H4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	1.3e-23	95.3	Ligand-binding domain of nuclear hormone receptor
2	PF17093 PBP_N	64	15.0	Penicillin-binding protein N-terminus
3	PF00105 zf-C4	2.7e-21	87.1	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253727

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363817	0.997	Retinoic acid receptor RXR-beta
2	9606.ENSP00000352900	0.995	Retinoic acid receptor RXR-gamma
3	9606.ENSP00000419692	0.993	Retinoic acid receptor RXR-alpha
4	9606.ENSP00000363868	0.989	ATP-binding cassette sub-family A member 1
5	9606.ENSP00000260645	0.978	ATP-binding cassette sub-family G member 5
6	9606.ENSP00000348069	0.978	Sterol regulatory element-binding protein 1
7	9606.ENSP00000272286	0.976	ATP-binding cassette sub-family G member 8
8	9606.ENSP00000354995	0.974	ATP-binding cassette sub-family G member 1
9	9606.ENSP00000304592	0.956	Fatty acid synthase
10	9606.ENSP00000252486	0.954	Apolipoprotein E
11	9606.ENSP00000349298	0.954	E3 ubiquitin-protein ligase MYLIP
12	9606.ENSP00000268712	0.950	Nuclear receptor corepressor 1
13	9606.ENSP00000417138	0.939	Phospholipid transfer protein
14	9606.ENSP00000264606	0.934	Histone deacetylase 4
15	9606.ENSP00000384018	0.933	Nuclear receptor corepressor 2
16	9606.ENSP00000359380	0.931	Acyl-CoA desaturase
17	9606.ENSP00000200676	0.930	Cholesteryl ester transfer protein
18	9606.ENSP00000371532	0.922	Very low-density lipoprotein receptor
19	9606.ENSP00000385216	0.918	Nuclear receptor coactivator 1
20	9606.ENSP00000465356	0.918	Apolipoprotein C-I

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.998	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0038023	0.986	signaling receptor activity
GO:0098531	0.890	ligand-activated transcription factor activity
GO:0000987	0.824	cis-regulatory region sequence-specific DNA binding
GO:0004879	0.808	nuclear receptor activity
GO:0000978	0.709	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0008134	0.595	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.995	regulation of primary metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0009893	0.995	positive regulation of metabolic process
GO:0009889	0.993	regulation of biosynthetic process
GO:0010468	0.992	regulation of gene expression
GO:0048522	0.990	positive regulation of cellular process
GO:0010604	0.989	positive regulation of macromolecule metabolic process
GO:0051173	0.979	positive regulation of nitrogen compound metabolic process
GO:0031325	0.976	positive regulation of cellular metabolic process
GO:0006357	0.975	regulation of transcription by RNA polymerase II
GO:0009987	0.963	cellular process
GO:0031328	0.961	positive regulation of cellular biosynthetic process
GO:0010557	0.957	positive regulation of macromolecule biosynthetic process
GO:0051254	0.955	positive regulation of RNA metabolic process
GO:0032368	0.954	regulation of lipid transport
GO:0045893	0.943	positive regulation of DNA-templated transcription
GO:0032373	0.937	positive regulation of sterol transport
GO:0048519	0.927	negative regulation of biological process
GO:0071704	0.916	organic substance metabolic process
GO:0044238	0.847	primary metabolic process
GO:0048523	0.825	negative regulation of cellular process
GO:0045944	0.823	positive regulation of transcription by RNA polymerase II
GO:0032374	0.783	regulation of cholesterol transport
GO:0009892	0.752	negative regulation of metabolic process
GO:0010874	0.732	regulation of cholesterol efflux
GO:0010883	0.603	regulation of lipid storage
GO:0050896	0.598	response to stimulus
GO:0044237	0.574	cellular metabolic process
GO:0010605	0.551	negative regulation of macromolecule metabolic process
GO:0051172	0.521	negative regulation of nitrogen compound metabolic process
GO:0009890	0.511	negative regulation of biosynthetic process
GO:0031324	0.508	negative regulation of cellular metabolic process
GO:0051716	0.448	cellular response to stimulus
GO:0006807	0.447	nitrogen compound metabolic process
GO:0031327	0.433	negative regulation of cellular biosynthetic process
GO:0032501	0.389	multicellular organismal process
GO:0065009	0.357	regulation of molecular function
GO:0010558	0.323	negative regulation of macromolecule biosynthetic process
GO:0006629	0.319	lipid metabolic process
GO:0007154	0.314	cell communication
GO:0051128	0.305	regulation of cellular component organization
GO:0032376	0.303	positive regulation of cholesterol transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.996	protein-containing complex
GO:0005654	0.996	nucleoplasm
GO:0005829	0.992	cytosol
GO:0005667	0.383	transcription regulator complex
GO:0140513	0.341	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]