StarFunc result for job id P55058

User Input

>input (493 residues)
MALFGALFLALLAGAHAEFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGH
FYYNISEVKVTELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFFYDGGYINASA
EGVSIRTGLELSRDPAGRMKVSNVSCQASVSRMHAAFGGTFKKVYDFLSTFITSGMRFLL
NQQICPVLYHAGTVLLNSLLDTVPVRSSVDELVGIDYSLMKDPVASTSNLDMDFRGAFFP
LTERNWSLPNRAVEPQLQEEERMVYVAFSEFFFDSAMESYFRAGALQLLLVGDKVPHDLD
MLLRATYFGSIVLLSPAVIDSPLKLELRVLAPPRCTIKPSGTTISVTASVTIALVPPDQP
EVQLSSMTMDARLSAKMALRGKALRTQLDLRRFRIYSNHSALESLALIPLQAPLKTMLQI
GVMPMLNERTWRGVQIPLPEGINFVHEVVTNHAGFLTIGADLHFAKGLREVIEKNRPADV
RASTAPTPSTAAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WMN7	0.963	0.957	4.516E-91	496	0.931	0.925	Q8WMN7.pdb.gz	Q8WMN7_PIG Plasma phospholipid transfer protein OS=Sus scrofa OX=9823 GN=PLTP PE=2 SV=1
2	AFDB:P55065	0.966	0.966	6.064E-88	493	0.826	0.826	P55065.pdb.gz	PLTP_MOUSE Phospholipid transfer protein OS=Mus musculus OX=10090 GN=Pltp PE=1 SV=1
3	AFDB:P18428	0.823	0.842	8.819E-44	481	0.229	0.235	P18428.pdb.gz	LBP_HUMAN Lipopolysaccharide-binding protein OS=Homo sapiens OX=9606 GN=LBP PE=1 SV=3
4	AFDB:Q67E05	0.835	0.851	2.430E-43	483	0.237	0.242	Q67E05.pdb.gz	BPI_MOUSE Bactericidal permeability-increasing protein OS=Mus musculus OX=10090 GN=Bpi PE=1 SV=1
5	AFDB:Q6AXU0	0.848	0.866	6.349E-43	482	0.237	0.243	Q6AXU0.pdb.gz	BPI_RAT Bactericidal permeability-increasing protein OS=Rattus norvegicus OX=10116 GN=Bpi PE=2 SV=1
6	AFDB:P17213	0.825	0.835	7.064E-43	487	0.235	0.238	P17213.pdb.gz	BPI_HUMAN Bactericidal permeability-increasing protein OS=Homo sapiens OX=9606 GN=BPI PE=1 SV=4
7	AFDB:P17454	0.808	0.826	1.270E-42	482	0.243	0.249	P17454.pdb.gz	LBP_RABIT Lipopolysaccharide-binding protein OS=Oryctolagus cuniculus OX=9986 GN=LBP PE=1 SV=2
8	PDB:1bp1A	0.805	0.866	1.699E-42	456	0.233	0.252	1bp1A.pdb.gz
9	AFDB:Q63313	0.826	0.846	4.822E-42	481	0.233	0.239	Q63313.pdb.gz	LBP_RAT Lipopolysaccharide-binding protein OS=Rattus norvegicus OX=10116 GN=Lbp PE=2 SV=1
10	AFDB:Q61805	0.838	0.858	5.086E-42	481	0.241	0.247	Q61805.pdb.gz	LBP_MOUSE Lipopolysaccharide-binding protein OS=Mus musculus OX=10090 GN=Lbp PE=1 SV=2
11	PDB:4m4dA	0.621	0.678	1.895E-36	448	0.213	0.234	4m4dA.pdb.gz
12	AFDB:Q9MAU5	0.787	0.794	3.510E-36	488	0.174	0.176	Q9MAU5.pdb.gz	Y1049_ARATH Putative BPI/LBP family protein At1g04970 OS=Arabidopsis thaliana OX=3702 GN=At1g04970 PE=2 SV=1
13	PDB:4ewsA	0.633	0.658	2.481E-30	472	0.191	0.199	4ewsA.pdb.gz	Crystal structures of cholesteryl ester transfer protein in complex with inhibitors.
14	PDB:3h4zA	0.241	0.214	2.766E-5	568	0.034	0.030	3h4zA.pdb.gz	The structure of the dust mite allergen Der p 7 reveals similarities to innate immune proteins.
15	PDB:3zpmA	0.163	0.304	2.215E-4	211	0.075	0.175	3zpmA.pdb.gz
16	PDB:6baqF	0.144	0.270	1.098E-3	211	0.043	0.100	6baqF.pdb.gz
17	PDB:7r5jK0	0.077	0.047	3.950E-3	1086	0.089	0.041	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
18	PDB:4kegA	0.155	0.146	7.104E-3	535	0.047	0.043	4kegA.pdb.gz	The Lipid Ligands of the SPLUNC1 Protein
19	PDB:7dmeA	0.151	0.218	1.211E-2	308	0.069	0.110	7dmeA.pdb.gz
20	PDB:6xlfC	0.158	0.218	1.856E-2	316	0.077	0.120	6xlfC.pdb.gz	Cryo-EM structures reveal a multistep mechanism of Hsp90 activation by co-chaperone Aha1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P55058	0.0	1011	493	1.000	1.000	PLTP_HUMAN Phospholipid transfer protein OS=Homo sapiens OX=9606 GN=PLTP PE=1 SV=1
2	P55065	0.0	823	493	0.795	0.795	PLTP_MOUSE Phospholipid transfer protein OS=Mus musculus OX=10090 GN=Pltp PE=1 SV=1
3	Q8WMN7	0.0	920	496	0.909	0.903	Q8WMN7_PIG Plasma phospholipid transfer protein OS=Sus scrofa OX=9823 GN=PLTP PE=2 SV=1
4	P17213	3.31e-46	169	487	0.252	0.255	BPI_HUMAN Bactericidal permeability-increasing protein OS=Homo sapiens OX=9606 GN=BPI PE=1 SV=4
5	Q61805	1.38e-40	154	481	0.243	0.249	LBP_MOUSE Lipopolysaccharide-binding protein OS=Mus musculus OX=10090 GN=Lbp PE=1 SV=2
6	Q6AXU0	2.07e-39	150	482	0.247	0.253	BPI_RAT Bactericidal permeability-increasing protein OS=Rattus norvegicus OX=10116 GN=Bpi PE=2 SV=1
7	P17454	8.80e-38	146	482	0.233	0.239	LBP_RABIT Lipopolysaccharide-binding protein OS=Oryctolagus cuniculus OX=9986 GN=LBP PE=1 SV=2
8	Q67E05	8.49e-33	132	483	0.229	0.234	BPI_MOUSE Bactericidal permeability-increasing protein OS=Mus musculus OX=10090 GN=Bpi PE=1 SV=1
9	Q63313	1.14e-32	132	481	0.227	0.233	LBP_RAT Lipopolysaccharide-binding protein OS=Rattus norvegicus OX=10116 GN=Lbp PE=2 SV=1
10	P18428	1.19e-32	132	481	0.225	0.231	LBP_HUMAN Lipopolysaccharide-binding protein OS=Homo sapiens OX=9606 GN=LBP PE=1 SV=3
11	P11597	6.14e-20	94.7	493	0.187	0.187	CETP_HUMAN Cholesteryl ester transfer protein OS=Homo sapiens OX=9606 GN=CETP PE=1 SV=2
12	P47896	1.99e-18	90.1	493	0.185	0.185	CETP_MACFA Cholesteryl ester transfer protein OS=Macaca fascicularis OX=9541 GN=CETP PE=1 SV=1
13	G3HIK4	3.34e-16	83.2	492	0.185	0.185	CETP_CRIGR Cholesteryl ester transfer protein OS=Cricetulus griseus OX=10029 GN=CETP PE=3 SV=2
14	P22687	1.12e-14	78.6	497	0.183	0.181	CETP_RABIT Cholesteryl ester transfer protein (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=CETP PE=1 SV=1
15	F4JDK0	2.13e-12	72.0	722	0.195	0.133	F4JDK0_ARATH Lipid-binding serum glycoprotein family protein OS=Arabidopsis thaliana OX=3702 GN=LBR-2 PE=1 SV=1
16	Q9MAU5	4.00e-10	64.3	488	0.191	0.193	Y1049_ARATH Putative BPI/LBP family protein At1g04970 OS=Arabidopsis thaliana OX=3702 GN=At1g04970 PE=2 SV=1
17	Q8N4F0	0.078	37.7	458	0.195	0.210	BPIB2_HUMAN BPI fold-containing family B member 2 OS=Homo sapiens OX=9606 GN=BPIFB2 PE=1 SV=2
18	A0A669KBJ0	0.40	35.8	736	0.051	0.034	A0A669KBJ0_HUMAN BPI fold containing family B member 4 OS=Homo sapiens OX=9606 GN=BPIFB4 PE=1 SV=1
19	P59827	0.43	35.8	614	0.051	0.041	BPIB4_HUMAN BPI fold-containing family B member 4 OS=Homo sapiens OX=9606 GN=BPIFB4 PE=2 SV=2
20	Q3T906	3.9	32.7	1256	0.051	0.020	GNPTA_HUMAN N-acetylglucosamine-1-phosphotransferase subunits alpha/beta OS=Homo sapiens OX=9606 GN=GNPTAB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01273 LBP_BPI_CETP	5.5e-36	135.1	LBP / BPI / CETP family, N-terminal domain
2	PF02886 LBP_BPI_CETP_C	1.1e-79	278.8	LBP / BPI / CETP family, C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417138

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000236850	0.999	Apolipoprotein A-I
2	9606.ENSP00000252486	0.975	Apolipoprotein E
3	9606.ENSP00000356969	0.962	Apolipoprotein A-II
4	9606.ENSP00000315130	0.954	Clusterin
5	9606.ENSP00000477707	0.952	Oxysterols receptor LXR-alpha
6	9606.ENSP00000264005	0.942	Phosphatidylcholine-sterol acyltransferase
7	9606.ENSP00000253727	0.939	Oxysterols receptor LXR-beta
8	9606.ENSP00000363868	0.936	ATP-binding cassette sub-family A member 1
9	9606.ENSP00000233242	0.931	Apolipoprotein B-100
10	9606.ENSP00000321334	0.928	Apolipoprotein(a)
11	9606.ENSP00000419692	0.913	Retinoic acid receptor RXR-alpha
12	9606.ENSP00000363817	0.902	Retinoic acid receptor RXR-beta
13	9606.ENSP00000222381	0.894	Serum paraoxonase/arylesterase 1
14	9606.ENSP00000466775	0.886	Apolipoprotein C-II
15	9606.ENSP00000227667	0.883	Apolipoprotein C-III
16	9606.ENSP00000365081	0.879	Apolipoprotein M
17	9606.ENSP00000465356	0.879	Apolipoprotein C-I
18	9606.ENSP00000445002	0.860	Apolipoprotein A-V
19	9606.ENSP00000387654	0.852	Prenylcysteine oxidase 1
20	9606.ENSP00000468236	0.843	Apolipoprotein C-IV

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008525	0.999	phosphatidylcholine transporter activity
GO:0046624	0.996	sphingolipid transporter activity
GO:0120014	0.996	phospholipid transfer activity
GO:0005488	0.986	binding
GO:0008289	0.983	lipid binding
GO:0005515	0.925	protein binding
GO:0120020	0.920	cholesterol transfer activity
GO:0097367	0.690	carbohydrate derivative binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032374	0.995	regulation of cholesterol transport
GO:0032373	0.995	positive regulation of sterol transport
GO:0071704	0.991	organic substance metabolic process
GO:0009987	0.984	cellular process
GO:0032376	0.968	positive regulation of cholesterol transport
GO:0010874	0.967	regulation of cholesterol efflux
GO:0050794	0.955	regulation of cellular process
GO:0010876	0.945	lipid localization
GO:0006869	0.939	lipid transport
GO:0044238	0.899	primary metabolic process
GO:0032501	0.832	multicellular organismal process
GO:0048522	0.768	positive regulation of cellular process
GO:0071840	0.753	cellular component organization or biogenesis
GO:0051128	0.740	regulation of cellular component organization
GO:0016043	0.733	cellular component organization
GO:0097006	0.640	regulation of plasma lipoprotein particle levels
GO:0071825	0.600	protein-lipid complex subunit organization
GO:0006629	0.570	lipid metabolic process
GO:0044237	0.568	cellular metabolic process
GO:0071827	0.499	plasma lipoprotein particle organization
GO:0051239	0.477	regulation of multicellular organismal process
GO:0044087	0.404	regulation of cellular component biogenesis
GO:0015748	0.335	organophosphate ester transport
GO:0044281	0.322	small molecule metabolic process
GO:0043254	0.304	regulation of protein-containing complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0043226	0.955	organelle
GO:0043227	0.954	membrane-bounded organelle
GO:0032991	0.933	protein-containing complex
GO:0043231	0.866	intracellular membrane-bounded organelle
GO:0032994	0.841	protein-lipid complex
GO:0034358	0.813	plasma lipoprotein particle
GO:0034364	0.600	high-density lipoprotein particle
GO:0005634	0.573	nucleus
GO:0005737	0.510	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:39747	0.921	cholesterol(in) = cholesterol(out)

[back to server]