StarFunc result for job id P55060

User Input

>input (971 residues)
MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPLLLLTLLEKSQDNVIKV
CASVTFKNYIKRNWRIVEDEPNKICEADRVAIKANIVHLMLSSPEQIQKQLSDAISIIGR
EDFPQKWPDLLTEMVNRFQSGDFHVINGVLRTAHSLFKRYRHEFKSNELWTEIKLVLDAF
ALPLTNLFKATIELCSTHANDASALRILFSSLILISKLFYSLNFQDLPEFFEDNMETWMN
NFHTLLTLDNKLLQTDDEEEAGLLELLKSQICDNAALYAQKYDEEFQRYLPRFVTAIWNL
LVTTGQEVKYDLLVSNAIQFLASVCERPHYKNLFEDQNTLTSICEKVIVPNMEFRAADEE
AFEDNSEEYIRRDLEGSDIDTRRRAACDLVRGLCKFFEGPVTGIFSGYVNSMLQEYAKNP
SVNWKHKDAAIYLVTSLASKAQTQKHGITQANELVNLTEFFVNHILPDLKSANVNEFPVL
KADGIKYIMIFRNQVPKEHLLVSIPLLINHLQAESIVVHTYAAHALERLFTMRGPNNATL
FTAAEIAPFVEILLTNLFKALTLPGSSENEYIMKAIMRSFSLLQEAIIPYIPTLITQLTQ
KLLAVSKNPSKPHFNHYMFEAICLSIRITCKANPAAVVNFEEALFLVFTEILQNDVQEFI
PYVFQVMSLLLETHKNDIPSSYMALFPHLLQPVLWERTGNIPALVRLLQAFLERGSNTIA
SAAADKIPGLLGVFQKLIASKANDHQGFYLLNSIIEHMPPESVDQYRKQIFILLFQRLQN
SKTTKFIKSFLVFINLYCIKYGALALQEIFDGIQPKMFGMVLEKIIIPEIQKVSGNVEKK
ICAVGITKLLTECPPMMDTEYTKLWTPLLQSLIGLFELPEDDTIPDEEHFIDIEDTPGYQ
TAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQ
GYLQAASVTLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384NKW7	0.969	0.969	0.000	971	1.000	1.000	A0A384NKW7.pdb.gz	A0A384NKW7_HUMAN Exportin-2 OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q7SZC2	0.994	0.994	2.958E-100	971	0.866	0.866	Q7SZC2.pdb.gz	XPO2_DANRE Exportin-2 OS=Danio rerio OX=7955 GN=cse1l PE=1 SV=2
3	AFDB:Q9XZU1	0.967	0.963	1.641E-72	975	0.520	0.518	Q9XZU1.pdb.gz	XPO2_DROME Exportin-2 OS=Drosophila melanogaster OX=7227 GN=Cse1 PE=2 SV=2
4	AFDB:Q9ZPY7	0.902	0.901	2.507E-56	972	0.389	0.389	Q9ZPY7.pdb.gz	XPO2_ARATH Exportin-2 OS=Arabidopsis thaliana OX=3702 GN=CAS PE=2 SV=1
5	AFDB:Q5AYN9	0.931	0.941	1.572E-52	961	0.358	0.362	Q5AYN9.pdb.gz	Q5AYN9_EMENI Importin N-terminal domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06591 PE=3 SV=1
6	AFDB:O13671	0.818	0.821	3.753E-51	967	0.376	0.377	O13671.pdb.gz	CSE1_SCHPO Importin-alpha re-exporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kap109 PE=3 SV=2
7	AFDB:P33307	0.863	0.873	7.334E-51	960	0.346	0.350	P33307.pdb.gz	CSE1_YEAST Importin alpha re-exporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSE1 PE=1 SV=2
8	PDB:1wa5C	0.752	0.766	4.900E-48	950	0.342	0.349	1wa5C.pdb.gz	Structural basis for the assembly of a nuclear export complex.
9	PDB:1z3hB	0.834	0.883	5.472E-42	914	0.339	0.360	1z3hB.pdb.gz	The structure of the nuclear export receptor cse1 in its cytosolic state reveals a closed conformation incompatible with cargo binding
10	AFDB:Q587E0	0.831	0.840	2.081E-39	960	0.281	0.284	Q587E0.pdb.gz	Q587E0_TRYB2 Importin-alpha re-exporter protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.200 PE=3 SV=1
11	AFDB:F4IRR2	0.683	0.644	5.514E-25	1040	0.194	0.181	F4IRR2.pdb.gz	SAD2_ARATH Importin beta-like SAD2 OS=Arabidopsis thaliana OX=3702 GN=SAD2 PE=1 SV=1
12	AFDB:O42480	0.758	0.714	7.490E-24	1038	0.194	0.181	O42480.pdb.gz	O42480_XENLA Importin 7 L homeolog OS=Xenopus laevis OX=8355 GN=ipo7.L PE=1 SV=1
13	PDB:6n1zA	0.495	0.499	3.526E-18	961	0.149	0.151	6n1zA.pdb.gz
14	PDB:6fvbA	0.558	0.544	5.726E-14	1001	0.160	0.155	6fvbA.pdb.gz
15	PDB:4jlqA	0.422	0.476	1.520E-12	840	0.135	0.156	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
16	PDB:6ahoA	0.520	0.543	8.762E-11	916	0.134	0.142	6ahoA.pdb.gz
17	PDB:6xu2A	0.380	0.344	1.009E-10	1091	0.128	0.114	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
18	PDB:3w3uA	0.343	0.331	1.162E-10	1030	0.164	0.154	3w3uA.pdb.gz
19	PDB:1qgkA	0.429	0.465	2.614E-10	876	0.138	0.153	1qgkA.pdb.gz
20	PDB:3w3zA	0.349	0.340	3.465E-10	1013	0.170	0.163	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384NKW7	0.0	2003	971	1.000	1.000	A0A384NKW7_HUMAN Exportin-2 OS=Homo sapiens OX=9606 PE=2 SV=1
2	O13671	0.0	594	967	0.387	0.389	CSE1_SCHPO Importin-alpha re-exporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kap109 PE=3 SV=2
3	P33307	0.0	590	960	0.358	0.362	CSE1_YEAST Importin alpha re-exporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSE1 PE=1 SV=2
4	P55060	0.0	2003	971	1.000	1.000	XPO2_HUMAN Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3
5	Q5AYN9	0.0	593	961	0.360	0.364	Q5AYN9_EMENI Importin N-terminal domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06591 PE=3 SV=1
6	Q7SZC2	0.0	1746	971	0.866	0.866	XPO2_DANRE Exportin-2 OS=Danio rerio OX=7955 GN=cse1l PE=1 SV=2
7	Q9ERK4	0.0	1987	971	0.991	0.991	XPO2_MOUSE Exportin-2 OS=Mus musculus OX=10090 GN=Cse1l PE=1 SV=1
8	Q9XZU1	0.0	1027	975	0.522	0.520	XPO2_DROME Exportin-2 OS=Drosophila melanogaster OX=7227 GN=Cse1 PE=2 SV=2
9	Q9ZPY7	0.0	722	972	0.391	0.391	XPO2_ARATH Exportin-2 OS=Arabidopsis thaliana OX=3702 GN=CAS PE=2 SV=1
10	Q587E0	8.24e-113	372	960	0.287	0.291	Q587E0_TRYB2 Importin-alpha re-exporter protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.200 PE=3 SV=1
11	Q86NK4	5.40e-27	121	1049	0.118	0.110	Q86NK4_DROME GH01576p OS=Drosophila melanogaster OX=7227 GN=msk PE=2 SV=1
12	Q7KIF8	5.58e-27	121	1049	0.118	0.110	Q7KIF8_DROME Ran binding protein 7 OS=Drosophila melanogaster OX=7227 GN=msk PE=2 SV=1
13	Q9VSD6	5.63e-27	121	1049	0.118	0.110	Q9VSD6_DROME D-Importin 7/RanBP7 OS=Drosophila melanogaster OX=7227 GN=msk PE=1 SV=1
14	F4IRR2	2.84e-21	102	1040	0.204	0.190	SAD2_ARATH Importin beta-like SAD2 OS=Arabidopsis thaliana OX=3702 GN=SAD2 PE=1 SV=1
15	O95373	4.78e-19	95.5	1038	0.124	0.116	IPO7_HUMAN Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1
16	Q9EPL8	6.34e-19	95.1	1038	0.124	0.116	IPO7_MOUSE Importin-7 OS=Mus musculus OX=10090 GN=Ipo7 PE=1 SV=2
17	O42480	2.76e-16	86.7	1038	0.120	0.113	O42480_XENLA Importin 7 L homeolog OS=Xenopus laevis OX=8355 GN=ipo7.L PE=1 SV=1
18	O15397	5.00e-15	82.4	1037	0.201	0.188	IPO8_HUMAN Importin-8 OS=Homo sapiens OX=9606 GN=IPO8 PE=1 SV=2
19	O59809	1.30e-10	68.2	1029	0.047	0.045	IMA3_SCHPO Probable importin c550.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC550.11 PE=3 SV=1
20	Q96P70	1.16e-07	58.5	1041	0.036	0.034	IPO9_HUMAN Importin-9 OS=Homo sapiens OX=9606 GN=IPO9 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03378 CAS_CSE1	1.7e-175	595.5	CAS/CSE protein, C-terminus
2	PF08506 Cse1	4e-152	518.0	Cse1
3	PF03810 IBN_N	5.3e-07	40.8	Importin-beta N-terminal domain
4	PF08389 Xpo1	1e+02	14.3	Exportin 1-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000025846

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000017054	0.972	Importin subunit alpha
2	9593.ENSGGOP00000007915	0.969	Karyopherin (importin) beta 1
3	9593.ENSGGOP00000023342	0.943	Importin 4
4	9593.ENSGGOP00000008551	0.906	Importin 5
5	9593.ENSGGOP00000014967	0.892	GTP-binding nuclear protein Ran
6	9593.ENSGGOP00000025525	0.892	Uncharacterized protein
7	9593.ENSGGOP00000008366	0.884	Uncharacterized protein
8	9593.ENSGGOP00000021001	0.876	Importin subunit alpha
9	9593.ENSGGOP00000000723	0.866	Importin subunit alpha
10	9593.ENSGGOP00000023736	0.860	RAN binding protein 6
11	9593.ENSGGOP00000021091	0.842	Nucleoporin 155kDa
12	9593.ENSGGOP00000000408	0.796	Uncharacterized protein
13	9593.ENSGGOP00000028496	0.796	Uncharacterized protein
14	9593.ENSGGOP00000020098	0.791	Importin subunit alpha
15	9593.ENSGGOP00000003939	0.783	Importin subunit alpha
16	9593.ENSGGOP00000011620	0.783	Importin subunit alpha
17	9593.ENSGGOP00000023508	0.774	Ribonucleoside-diphosphate reductase
18	9593.ENSGGOP00000012284	0.765	Functions as a component of the nuclear pore complex (NPC).
19	9593.ENSGGOP00000005862	0.752	DExD-box helicase 39B
20	9593.ENSGGOP00000028667	0.746	Exportin 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140104	0.585	molecular carrier activity
GO:0140142	0.515	nucleocytoplasmic carrier activity
GO:0003676	0.445	nucleic acid binding
GO:0003723	0.444	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.988	biological regulation
GO:0051179	0.951	localization
GO:0051234	0.937	establishment of localization
GO:0006810	0.900	transport
GO:0009987	0.884	cellular process
GO:0050878	0.636	regulation of body fluid levels
GO:0051641	0.538	cellular localization
GO:0046903	0.458	secretion
GO:0006913	0.439	nucleocytoplasmic transport
GO:0050789	0.423	regulation of biological process
GO:0033036	0.398	macromolecule localization
GO:0050794	0.394	regulation of cellular process
GO:0008104	0.375	protein localization
GO:0071702	0.349	organic substance transport
GO:0008152	0.327	metabolic process
GO:0007589	0.307	body fluid secretion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.999	nucleoplasm
GO:0016020	0.556	membrane
GO:0012505	0.412	endomembrane system
GO:0005576	0.370	extracellular region
GO:0031975	0.367	envelope
GO:0031967	0.356	organelle envelope
GO:0032991	0.320	protein-containing complex
GO:0070062	0.309	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]