StarFunc result for job id P55061

User Input

>input (237 residues)
MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLS
ALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMG
TAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVV
MCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILAMNEKDKKKEKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55061	1.000	1.000	2.238E-30	237	1.000	1.000	P55061.pdb.gz	BI1_HUMAN Bax inhibitor 1 OS=Homo sapiens OX=9606 GN=TMBIM6 PE=1 SV=2
2	AFDB:Q9LD45	0.907	0.872	1.892E-16	247	0.426	0.409	Q9LD45.pdb.gz	BI1_ARATH Bax inhibitor 1 OS=Arabidopsis thaliana OX=3702 GN=BI-1 PE=1 SV=1
3	AFDB:Q9VSH3	0.901	0.872	1.422E-14	245	0.346	0.335	Q9VSH3.pdb.gz	BI1_DROME Bax inhibitor 1 OS=Drosophila melanogaster OX=7227 GN=BI-1 PE=2 SV=1
4	AFDB:P0AAC6	0.767	0.827	2.713E-8	219	0.232	0.251	P0AAC6.pdb.gz	YCCA_ECOLI Modulator of FtsH protease YccA OS=Escherichia coli (strain K12) OX=83333 GN=yccA PE=1 SV=1
5	AFDB:Q9HC24	0.765	0.762	8.372E-8	238	0.245	0.244	Q9HC24.pdb.gz	LFG4_HUMAN Protein lifeguard 4 OS=Homo sapiens OX=9606 GN=TMBIM4 PE=1 SV=3
6	AFDB:G3XAA5	0.743	0.625	4.132E-7	285	0.245	0.204	G3XAA5.pdb.gz	G3XAA5_HUMAN Transmembrane BAX inhibitor motif containing 4 OS=Homo sapiens OX=9606 GN=TMBIM4 PE=3 SV=3
7	AFDB:Q9VIB2	0.660	0.445	4.538E-7	365	0.253	0.164	Q9VIB2.pdb.gz	Q9VIB2_DROME MIP04261p OS=Drosophila melanogaster OX=7227 GN=Mics1 PE=2 SV=2
8	AFDB:Q91VC9	0.807	0.565	4.757E-7	346	0.198	0.136	Q91VC9.pdb.gz	GHITM_MOUSE Growth hormone-inducible transmembrane protein OS=Mus musculus OX=10090 GN=Ghitm PE=1 SV=1
9	AFDB:P0AAC4	0.704	0.712	5.225E-7	234	0.236	0.239	P0AAC4.pdb.gz	YBHL_ECOLI Inner membrane protein YbhL OS=Escherichia coli (strain K12) OX=83333 GN=ybhL PE=1 SV=1
10	AFDB:Q9DA39	0.734	0.732	6.304E-7	238	0.215	0.214	Q9DA39.pdb.gz	LFG4_MOUSE Protein lifeguard 4 OS=Mus musculus OX=10090 GN=Tmbim4 PE=2 SV=1
11	PDB:7oqzA	0.248	0.248	5.568E-1	237	0.118	0.118	7oqzA.pdb.gz
12	PDB:6xz4A	0.192	0.157	9.782E-1	304	0.118	0.092	6xz4A.pdb.gz
13	PDB:2j68A	0.168	0.074	1.025	680	0.127	0.044	2j68A.pdb.gz	A Bacterial Dynamin-Like Protein
14	PDB:5iztA	0.144	0.157	1.297	211	0.122	0.137	5iztA.pdb.gz
15	PDB:7p5cA	0.150	0.099	1.359	392	0.127	0.077	7p5cA.pdb.gz
16	PDB:7uw9i	0.186	0.269	1.564	156	0.093	0.141	7uw9i.pdb.gz
17	PDB:3fhnA	0.167	0.074	2.173	673	0.114	0.040	3fhnA.pdb.gz
18	PDB:7c9iC	0.172	0.168	2.173	243	0.143	0.140	7c9iC.pdb.gz	Structural basis of gamma-secretase inhibition and modulation by small molecule drugs.
19	PDB:1kmiZ	0.207	0.266	2.622	177	0.118	0.158	1kmiZ.pdb.gz	Structure and catalytic mechanism of the E. coli chemotaxis phosphatase CheZ.
20	PDB:8a3tQ	0.134	0.069	2.622	623	0.135	0.051	8a3tQ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P55061	8.06e-176	484	237	1.000	1.000	BI1_HUMAN Bax inhibitor 1 OS=Homo sapiens OX=9606 GN=TMBIM6 PE=1 SV=2
2	Q9D2C7	1.48e-150	420	237	0.899	0.899	BI1_MOUSE Bax inhibitor 1 OS=Mus musculus OX=10090 GN=Tmbim6 PE=1 SV=1
3	P55062	1.24e-146	410	237	0.878	0.878	BI1_RAT Bax inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Tmbim6 PE=2 SV=2
4	Q9LD45	3.56e-48	160	247	0.418	0.401	BI1_ARATH Bax inhibitor 1 OS=Arabidopsis thaliana OX=3702 GN=BI-1 PE=1 SV=1
5	Q9VSH3	1.06e-44	152	245	0.342	0.331	BI1_DROME Bax inhibitor 1 OS=Drosophila melanogaster OX=7227 GN=BI-1 PE=2 SV=1
6	P0AAC6	3.26e-12	65.9	219	0.245	0.265	YCCA_ECOLI Modulator of FtsH protease YccA OS=Escherichia coli (strain K12) OX=83333 GN=yccA PE=1 SV=1
7	Q9VIB2	1.28e-09	59.7	365	0.278	0.181	Q9VIB2_DROME MIP04261p OS=Drosophila melanogaster OX=7227 GN=Mics1 PE=2 SV=2
8	O74888	4.42e-09	57.4	266	0.291	0.259	BXI1_SCHPO Bax inhibitor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bxi1 PE=3 SV=1
9	Q91VC9	8.76e-08	54.3	346	0.160	0.110	GHITM_MOUSE Growth hormone-inducible transmembrane protein OS=Mus musculus OX=10090 GN=Ghitm PE=1 SV=1
10	Q9H3K2	1.17e-07	53.9	345	0.160	0.110	GHITM_HUMAN Growth hormone-inducible transmembrane protein OS=Homo sapiens OX=9606 GN=GHITM PE=1 SV=2
11	Q9ZQX7	1.43e-07	53.1	248	0.173	0.165	LFG3_ARATH Protein LIFEGUARD 3 OS=Arabidopsis thaliana OX=3702 GN=LFG3 PE=2 SV=1
12	Q9HC24	3.32e-07	52.0	238	0.257	0.256	LFG4_HUMAN Protein lifeguard 4 OS=Homo sapiens OX=9606 GN=TMBIM4 PE=1 SV=3
13	G3XAA5	3.51e-07	52.0	285	0.257	0.214	G3XAA5_HUMAN Transmembrane BAX inhibitor motif containing 4 OS=Homo sapiens OX=9606 GN=TMBIM4 PE=3 SV=3
14	Q9M1V9	1.31e-06	50.1	239	0.207	0.205	LFG2_ARATH Protein LIFEGUARD 2 OS=Arabidopsis thaliana OX=3702 GN=LFG2 PE=2 SV=1
15	Q9DA39	4.31e-05	45.8	238	0.241	0.239	LFG4_MOUSE Protein lifeguard 4 OS=Mus musculus OX=10090 GN=Tmbim4 PE=2 SV=1
16	F4JIE8	1.15e-04	44.3	235	0.148	0.149	LFG1_ARATH Protein LIFEGUARD 1 OS=Arabidopsis thaliana OX=3702 GN=LFG1 PE=2 SV=1
17	P0AAC4	2.16e-04	43.5	234	0.190	0.192	YBHL_ECOLI Inner membrane protein YbhL OS=Escherichia coli (strain K12) OX=83333 GN=ybhL PE=1 SV=1
18	O88407	0.11	35.8	316	0.076	0.057	LFG2_RAT Protein lifeguard 2 OS=Rattus norvegicus OX=10116 GN=Faim2 PE=2 SV=1
19	Q8K097	0.11	35.8	317	0.076	0.057	LFG2_MOUSE Protein lifeguard 2 OS=Mus musculus OX=10090 GN=Faim2 PE=2 SV=1
20	G2WLG4	0.22	34.7	298	0.228	0.181	G2WLG4_YEASK K7_Ynl305cp OS=Saccharomyces cerevisiae (strain Kyokai no. 7 / NBRC 101557) OX=721032 GN=K7_YNL305C PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07695 7TMR-DISM_7TM	57	15.1	7TM diverse intracellular signalling
2	PF01027 Bax1-I	1.1e-38	144.7	Inhibitor of apoptosis-promoting Bax1
3	PF13886 DUF4203	23	16.1	Domain of unknown function (DUF4203)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003825893.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003826019.1	0.806	WAP four-disulfide core domain protein 8 isoform X1
2	9597.XP_003820554.1	0.775	Zinc finger protein 425
3	9597.XP_008959781.1	0.775	Zinc finger protein 197
4	9597.XP_003826023.1	0.774	WAP four-disulfide core domain 11
5	9597.XP_003824183.1	0.762	Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors.
6	9597.XP_003814620.1	0.736	Sphingomyelin phosphodiesterase 3
7	9597.XP_003832078.1	0.727	UDP-glucose:glycoprotein glucosyltransferase 2
8	9597.XP_003811410.1	0.708	Endoplasmic reticulum to nucleus signaling 1
9	9597.XP_008962192.1	0.683	protein-L-isoaspartate(D-aspartate) O-methyltransferase
10	9597.XP_003814978.1	0.653	Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors.
11	9597.XP_003829573.1	0.649	Catalyzes stereospecific hydroxylation of free fatty acids at the C-2 position to produce (R)-2-hydroxy fatty acids, which are building blocks of sphingolipids and glycosphingolipids common in neural tissue and epidermis. Plays an essential role in the synthesis of galactosphingolipids of the myelin sheath. Responsible for the synthesis of sphingolipids and glycosphingolipids involved in the formation of epidermal lamellar bodies critical for skin permeability barrier. Participates in the synthesis of glycosphingolipids and a fraction of type II wax diesters in sebaceous gland, specifi [...]
12	9597.XP_003814810.1	0.613	BCL2 like 1
13	9597.XP_003830973.1	0.594	Anthrax toxin receptor 1 isoform X1
14	9597.XP_003820553.1	0.586	Zinc finger protein 398 isoform X1
15	9597.XP_008971154.1	0.545	Sphingomyelin phosphodiesterase 3
16	9597.XP_003813749.1	0.543	Endoplasmic reticulum to nucleus signaling 2
17	9597.XP_008959071.1	0.528	Zinc finger protein 383
18	9597.XP_008969009.1	0.521	Participates in the apoptotic response to DNA damage. Isoforms containing the transactivation domain are pro-apoptotic, isoforms lacking the domain are anti-apoptotic and block the function of p53 and transactivating p73 isoforms. May be a tumor suppressor protein
19	9597.XP_008954853.1	0.515	Inositol 1,4,5-trisphosphate receptor type 1 isoform X1
20	9597.XP_008955190.1	0.510	Allograft inflammatory factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0004857	1.000	enzyme inhibitor activity
GO:0060698	0.967	endoribonuclease inhibitor activity
GO:0044389	0.911	ubiquitin-like protein ligase binding
GO:0031625	0.904	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.989	biological regulation
GO:0009987	0.983	cellular process
GO:0050794	0.978	regulation of cellular process
GO:0010941	0.919	regulation of cell death
GO:0060548	0.913	negative regulation of cell death
GO:0050896	0.904	response to stimulus
GO:0043067	0.902	regulation of programmed cell death
GO:0006950	0.865	response to stress
GO:0051716	0.865	cellular response to stimulus
GO:0033554	0.836	cellular response to stress
GO:0042221	0.835	response to chemical
GO:0043069	0.783	negative regulation of programmed cell death
GO:0034620	0.747	cellular response to unfolded protein
GO:0042981	0.720	regulation of apoptotic process
GO:0019222	0.701	regulation of metabolic process
GO:0060255	0.682	regulation of macromolecule metabolic process
GO:0051171	0.648	regulation of nitrogen compound metabolic process
GO:0080090	0.646	regulation of primary metabolic process
GO:0031323	0.646	regulation of cellular metabolic process
GO:0048583	0.633	regulation of response to stimulus
GO:0080134	0.596	regulation of response to stress
GO:0009966	0.542	regulation of signal transduction
GO:0043066	0.477	negative regulation of apoptotic process
GO:0010468	0.476	regulation of gene expression
GO:0080135	0.449	regulation of cellular response to stress
GO:0019219	0.449	regulation of nucleobase-containing compound metabolic process
GO:1905897	0.360	regulation of response to endoplasmic reticulum stress
GO:2001233	0.350	regulation of apoptotic signaling pathway
GO:0065009	0.349	regulation of molecular function
GO:0048585	0.315	negative regulation of response to stimulus
GO:0071704	0.312	organic substance metabolic process
GO:0009892	0.304	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0005634	0.998	nucleus
GO:0031090	0.995	organelle membrane
GO:0031967	0.995	organelle envelope
GO:0071944	0.984	cell periphery
GO:0042175	0.975	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005886	0.969	plasma membrane
GO:0005789	0.933	endoplasmic reticulum membrane
GO:0005739	0.915	mitochondrion
GO:0005740	0.804	mitochondrial envelope
GO:0031966	0.793	mitochondrial membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]