StarFunc result for job id P55075

User Input

>input (233 residues)
MGSPRSALSCLLLHLLVLCLQAQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLV
TDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGA
ETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKG
SKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55075	1.000	1.000	1.068E-45	233	1.000	1.000	P55075.pdb.gz	FGF8_HUMAN Fibroblast growth factor 8 OS=Homo sapiens OX=9606 GN=FGF8 PE=1 SV=1
2	AFDB:P37237	0.743	0.649	2.088E-39	268	0.923	0.802	P37237.pdb.gz	FGF8_MOUSE Fibroblast growth factor 8 OS=Mus musculus OX=10090 GN=Fgf8 PE=1 SV=1
3	AFDB:Q8AXC5	0.678	0.748	1.014E-34	211	0.700	0.773	Q8AXC5.pdb.gz	Q8AXC5_XENLA Fibroblast growth factor OS=Xenopus laevis OX=8355 GN=fgf8.L PE=2 SV=1
4	AFDB:Q4R0X9	0.686	0.746	1.140E-34	214	0.712	0.776	Q4R0X9.pdb.gz	Q4R0X9_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 GN=FGF8 PE=3 SV=1
5	AFDB:O57341	0.696	0.769	4.262E-32	210	0.652	0.724	O57341.pdb.gz	FGF8A_DANRE Fibroblast growth factor 8 OS=Danio rerio OX=7955 GN=fgf8a PE=2 SV=1
6	AFDB:O60258	0.641	0.690	1.479E-28	216	0.562	0.606	O60258.pdb.gz	FGF17_HUMAN Fibroblast growth factor 17 OS=Homo sapiens OX=9606 GN=FGF17 PE=1 SV=1
7	AFDB:Q6SJP8	0.626	0.677	1.009E-26	215	0.506	0.549	Q6SJP8.pdb.gz	FG17_DANRE Fibroblast growth factor 17 OS=Danio rerio OX=7955 GN=fgf17 PE=2 SV=1
8	AFDB:O76093	0.645	0.726	3.457E-26	207	0.485	0.546	O76093.pdb.gz	FGF18_HUMAN Fibroblast growth factor 18 OS=Homo sapiens OX=9606 GN=FGF18 PE=1 SV=1
9	AFDB:Q0IIQ7	0.679	0.759	9.085E-24	208	0.425	0.476	Q0IIQ7.pdb.gz	Q0IIQ7_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=si:zc207o21.1 PE=2 SV=1
10	AFDB:P48805	0.546	0.674	2.678E-17	187	0.245	0.305	P48805.pdb.gz	FGF4A_XENLA Fibroblast growth factor 4A OS=Xenopus laevis OX=8355 GN=fgf4-a PE=2 SV=1
11	PDB:4jq0A	0.525	0.854	2.131E-11	141	0.116	0.191	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
12	PDB:3f1rA	0.508	0.746	3.830E-11	157	0.176	0.261	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
13	PDB:1ry7A	0.508	0.771	4.498E-10	151	0.133	0.205	1ry7A.pdb.gz
14	PDB:6b0tA	0.489	0.243	2.093E-6	487	0.099	0.047	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
15	PDB:2d43A	0.443	0.225	1.833E-5	482	0.112	0.054	2d43A.pdb.gz	The family 42 carbohydrate-binding module of family 54 alpha-L-arabinofuranosidase specifically binds the arabinofuranose side chain of hemicellulose
16	PDB:4qd2B	0.456	0.706	2.606E-5	143	0.082	0.133	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
17	PDB:4qd2C	0.486	0.401	8.929E-5	286	0.052	0.042	4qd2C.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
18	PDB:3wmuB	0.422	0.613	1.346E-4	153	0.073	0.111	3wmuB.pdb.gz
19	PDB:4iybA	0.430	0.688	1.514E-4	140	0.094	0.157	4iybA.pdb.gz	Macrolepiota procera ricin B-like lectin (MPL) in complex with galactose
20	PDB:1t9fA	0.381	0.488	1.605E-4	178	0.094	0.124	1t9fA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P55075	5.91e-176	484	233	1.000	1.000	FGF8_HUMAN Fibroblast growth factor 8 OS=Homo sapiens OX=9606 GN=FGF8 PE=1 SV=1
2	A0A8I5ZL19	4.52e-157	437	244	0.987	0.943	A0A8I5ZL19_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf8 PE=3 SV=1
3	Q76LI5	6.73e-148	412	204	0.876	1.000	Q76LI5_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf8 PE=2 SV=1
4	P37237	6.82e-137	387	268	0.940	0.817	FGF8_MOUSE Fibroblast growth factor 8 OS=Mus musculus OX=10090 GN=Fgf8 PE=1 SV=1
5	A0A8I6B5D5	1.69e-136	385	268	0.936	0.813	A0A8I6B5D5_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf8 PE=3 SV=1
6	A0A8J8XTJ6	1.24e-133	375	189	0.811	1.000	A0A8J8XTJ6_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf8 PE=3 SV=1
7	Q8AXC5	7.58e-116	331	211	0.704	0.777	Q8AXC5_XENLA Fibroblast growth factor OS=Xenopus laevis OX=8355 GN=fgf8.L PE=2 SV=1
8	Q90722	4.90e-114	327	214	0.708	0.771	FGF8_CHICK Fibroblast growth factor 8 OS=Gallus gallus OX=9031 GN=FGF8 PE=2 SV=1
9	Q4R0X9	7.27e-114	326	214	0.704	0.766	Q4R0X9_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 GN=FGF8 PE=3 SV=1
10	Q90696	3.02e-113	324	204	0.691	0.789	Q90696_CHICK Fibroblast growth factor (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
11	O57341	1.46e-102	297	210	0.635	0.705	FGF8A_DANRE Fibroblast growth factor 8 OS=Danio rerio OX=7955 GN=fgf8a PE=2 SV=1
12	C4P6Q2	2.91e-100	290	175	0.618	0.823	C4P6Q2_CHICK Fibroblast growth factor (Fragment) OS=Gallus gallus OX=9031 GN=FGF8 PE=2 SV=1
13	P63075	7.06e-78	235	216	0.489	0.528	FGF17_MOUSE Fibroblast growth factor 17 OS=Mus musculus OX=10090 GN=Fgf17 PE=2 SV=1
14	O60258	8.59e-78	235	216	0.489	0.528	FGF17_HUMAN Fibroblast growth factor 17 OS=Homo sapiens OX=9606 GN=FGF17 PE=1 SV=1
15	Q6SJP8	1.95e-77	234	215	0.476	0.516	FG17_DANRE Fibroblast growth factor 17 OS=Danio rerio OX=7955 GN=fgf17 PE=2 SV=1
16	O89101	1.23e-67	209	207	0.403	0.454	FGF18_MOUSE Fibroblast growth factor 18 OS=Mus musculus OX=10090 GN=Fgf18 PE=2 SV=1
17	O88182	1.46e-67	209	207	0.403	0.454	FGF18_RAT Fibroblast growth factor 18 OS=Rattus norvegicus OX=10116 GN=Fgf18 PE=2 SV=1
18	O76093	1.96e-67	208	207	0.403	0.454	FGF18_HUMAN Fibroblast growth factor 18 OS=Homo sapiens OX=9606 GN=FGF18 PE=1 SV=1
19	Q0IIQ7	7.56e-62	194	208	0.442	0.495	Q0IIQ7_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=si:zc207o21.1 PE=2 SV=1
20	P36364	5.89e-16	75.9	208	0.197	0.221	FGF9_RAT Fibroblast growth factor 9 OS=Rattus norvegicus OX=10116 GN=Fgf9 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06268 Fascin	1.9e+02	13.7	Fascin domain
2	PF00167 FGF	8.4e-39	143.8	Fibroblast growth factor
3	PF18313 TLP1_add_C	2.8e+02	12.9	Thiolase-like protein type 1 additional C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321797

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000393312	0.999	Fibroblast growth factor receptor 1
2	9606.ENSP00000339824	0.997	Fibroblast growth factor receptor 3
3	9606.ENSP00000410294	0.978	Fibroblast growth factor receptor 2
4	9606.ENSP00000262648	0.975	Anosmin-1
5	9606.ENSP00000297261	0.969	Sonic hedgehog protein
6	9606.ENSP00000381498	0.947	Fibroblast growth factor receptor-like 1
7	9606.ENSP00000263025	0.940	Mitogen-activated protein kinase 3
8	9606.ENSP00000292408	0.939	Fibroblast growth factor receptor 4
9	9606.ENSP00000407586	0.939	GTPase HRas
10	9606.ENSP00000215832	0.922	Mitogen-activated protein kinase 1
11	9606.ENSP00000256078	0.915	GTPase KRas
12	9606.ENSP00000358548	0.911	GTPase NRas
13	9606.ENSP00000343819	0.871	Homeobox protein OTX2
14	9606.ENSP00000245451	0.862	Bone morphogenetic protein 4
15	9606.ENSP00000215530	0.823	Fibroblast growth factor 22
16	9606.ENSP00000302251	0.822	Homeobox protein GBX-2
17	9606.ENSP00000284523	0.810	Protein Wnt-3a
18	9606.ENSP00000263923	0.808	Vascular endothelial growth factor receptor 2
19	9606.ENSP00000293549	0.803	Proto-oncogene Wnt-1
20	9606.ENSP00000294312	0.802	Fibroblast growth factor 19

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048018	1.000	receptor ligand activity
GO:0042056	0.993	chemoattractant activity
GO:0008083	0.983	growth factor activity
GO:0005104	0.968	fibroblast growth factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.993	response to stimulus
GO:0048699	0.985	generation of neurons
GO:0050794	0.977	regulation of cellular process
GO:0042476	0.976	odontogenesis
GO:0048518	0.965	positive regulation of biological process
GO:0040011	0.915	locomotion
GO:0030182	0.897	neuron differentiation
GO:0007417	0.892	central nervous system development
GO:0032990	0.866	cell part morphogenesis
GO:0048522	0.846	positive regulation of cellular process
GO:0006950	0.819	response to stress
GO:0042221	0.775	response to chemical
GO:0048468	0.772	cell development
GO:0051716	0.767	cellular response to stimulus
GO:0000902	0.766	cell morphogenesis
GO:0021872	0.723	forebrain generation of neurons
GO:0021954	0.715	central nervous system neuron development
GO:0019222	0.692	regulation of metabolic process
GO:0021884	0.690	forebrain neuron development
GO:0048812	0.688	neuron projection morphogenesis
GO:0061564	0.686	axon development
GO:0008045	0.684	motor neuron axon guidance
GO:0060255	0.665	regulation of macromolecule metabolic process
GO:0009410	0.607	response to xenobiotic stimulus
GO:0009719	0.604	response to endogenous stimulus
GO:0006979	0.586	response to oxidative stress
GO:0009893	0.557	positive regulation of metabolic process
GO:0070848	0.551	response to growth factor
GO:0007154	0.545	cell communication
GO:0010604	0.542	positive regulation of macromolecule metabolic process
GO:0009888	0.540	tissue development
GO:0023052	0.515	signaling
GO:0080090	0.505	regulation of primary metabolic process
GO:0007165	0.479	signal transduction
GO:0031323	0.470	regulation of cellular metabolic process
GO:0048519	0.468	negative regulation of biological process
GO:0010468	0.455	regulation of gene expression
GO:0051171	0.452	regulation of nitrogen compound metabolic process
GO:0007166	0.443	cell surface receptor signaling pathway
GO:0007167	0.423	enzyme-linked receptor protein signaling pathway
GO:0042127	0.407	regulation of cell population proliferation
GO:0008284	0.386	positive regulation of cell population proliferation
GO:0048523	0.361	negative regulation of cellular process
GO:0050793	0.351	regulation of developmental process
GO:0071363	0.349	cellular response to growth factor stimulus
GO:0048583	0.341	regulation of response to stimulus
GO:0007169	0.339	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0051239	0.327	regulation of multicellular organismal process
GO:0009966	0.326	regulation of signal transduction
GO:0051173	0.307	positive regulation of nitrogen compound metabolic process
GO:0031325	0.305	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.997	membrane
GO:0005886	0.992	plasma membrane
GO:0005576	0.987	extracellular region
GO:0005615	0.872	extracellular space
GO:0098552	0.807	side of membrane
GO:0009897	0.801	external side of plasma membrane
GO:0005622	0.797	intracellular anatomical structure
GO:0043227	0.775	membrane-bounded organelle
GO:0043229	0.775	intracellular organelle
GO:0043231	0.766	intracellular membrane-bounded organelle
GO:0005737	0.476	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]