StarFunc result for job id P55084

User Input

>input (474 residues)
MTILTYPFKNLPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGV
RTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAA
LGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMR
KLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLE
QDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRPSSLEQMAKLKPAFIKPY
GTVTAANSSFLTDGASAMLIMAEEKALAMGYKPKAYLRDFMYVSQDPKDQLLLGPTYATP
KVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAENYMGRKTKVGLPPLEKFNNW
GGSLSLGHPFGATGCRLVMAAANRLRKEGGQYGLVAACAAGGQGHAMIVEAYPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55084	1.000	1.000	2.091E-102	474	1.000	1.000	P55084.pdb.gz	ECHB_HUMAN Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=3
2	AFDB:Q60587	0.929	0.927	1.368E-95	475	0.897	0.895	Q60587.pdb.gz	ECHB_RAT Trifunctional enzyme subunit beta, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hadhb PE=1 SV=1
3	PDB:6dv2A	0.879	0.962	9.990E-82	432	0.911	1.000	6dv2A.pdb.gz
4	AFDB:O77466	0.897	0.906	8.064E-76	469	0.646	0.652	O77466.pdb.gz	O77466_DROME Thiolase OS=Drosophila melanogaster OX=7227 GN=Mtpbeta PE=2 SV=1
5	AFDB:P34255	0.897	0.948	7.116E-69	448	0.574	0.607	P34255.pdb.gz	ECHH_CAEEL Probable 3-ketoacyl-CoA thiolase OS=Caenorhabditis elegans OX=6239 GN=B0303.3 PE=3 SV=1
6	AFDB:B5MD38	0.668	0.899	2.508E-59	351	0.741	1.000	B5MD38.pdb.gz	B5MD38_HUMAN Hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=1
7	AFDB:P76503	0.873	0.948	9.825E-54	436	0.378	0.411	P76503.pdb.gz	FADI_ECOLI 3-ketoacyl-CoA thiolase FadI OS=Escherichia coli (strain K12) OX=83333 GN=fadI PE=1 SV=1
8	AFDB:O86361	0.846	0.910	3.239E-46	440	0.352	0.380	O86361.pdb.gz	O86361_MYCTU Probable acetyl-CoA acyltransferase FadA2 (3-ketoacyl-CoA thiolase) (Beta-ketothiolase) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadA2 PE=1 SV=1
9	AFDB:P17764	0.759	0.846	1.612E-40	424	0.314	0.351	P17764.pdb.gz	THIL_RAT Acetyl-CoA acetyltransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acat1 PE=1 SV=1
10	AFDB:Q46939	0.755	0.905	1.929E-40	393	0.268	0.323	Q46939.pdb.gz	YQEF_ECOLI Probable acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=yqeF PE=3 SV=2
11	AFDB:P76461	0.766	0.916	2.452E-40	394	0.283	0.340	P76461.pdb.gz	ATOB_ECOLI Acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=atoB PE=1 SV=1
12	PDB:4wysA	0.766	0.911	3.209E-39	396	0.283	0.338	4wysA.pdb.gz
13	PDB:1wl4A	0.751	0.899	2.459E-38	394	0.270	0.325	1wl4A.pdb.gz	High Resolution Crystal Structures of Human Cytosolic Thiolase (CT): A Comparison of the Active Sites of Human CT, Bacterial Thiolase, and Bacterial KAS I
14	PDB:2iikB	0.718	0.847	2.611E-38	400	0.314	0.372	2iikB.pdb.gz
15	PDB:2ib8D	0.749	0.897	9.185E-38	393	0.278	0.336	2ib8D.pdb.gz	Crystallographic and Kinetic Studies of Human Mitochondrial Acetoacetyl-CoA Thiolase: The Importance of Potassium and Chloride Ions for Its Structure and Function
16	PDB:4c2kD	0.741	0.876	1.035E-37	399	0.295	0.351	4c2kD.pdb.gz
17	PDB:5xyjA	0.756	0.901	5.218E-37	396	0.274	0.328	5xyjA.pdb.gz
18	PDB:2d3tC	0.708	0.855	7.936E-37	390	0.304	0.369	2d3tC.pdb.gz	Ligand-Induced Domain Rearrangement of Fatty Acid beta-Oxidation Multienzyme Complex
19	PDB:2wu9A	0.708	0.829	8.206E-36	403	0.291	0.342	2wu9A.pdb.gz
20	PDB:5f38A	0.726	0.920	1.898E-35	371	0.270	0.345	5f38A.pdb.gz	Crystal structure of a thiolase from Escherichia coli at 1.8 angstrom resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F5GZQ3	0.0	939	459	0.968	1.000	F5GZQ3_HUMAN Hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=1
2	O77466	0.0	631	469	0.641	0.648	O77466_DROME Thiolase OS=Drosophila melanogaster OX=7227 GN=Mtpbeta PE=2 SV=1
3	P34255	0.0	567	448	0.584	0.618	ECHH_CAEEL Probable 3-ketoacyl-CoA thiolase OS=Caenorhabditis elegans OX=6239 GN=B0303.3 PE=3 SV=1
4	P55084	0.0	980	474	1.000	1.000	ECHB_HUMAN Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=3
5	Q60587	0.0	905	475	0.897	0.895	ECHB_RAT Trifunctional enzyme subunit beta, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hadhb PE=1 SV=1
6	Q99JY0	0.0	910	475	0.909	0.907	ECHB_MOUSE Trifunctional enzyme subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Hadhb PE=1 SV=1
7	Q9W1H8	0.0	637	469	0.646	0.652	Q9W1H8_DROME GH13256p OS=Drosophila melanogaster OX=7227 GN=Mtpbeta PE=1 SV=1
8	B5MD38	5.46e-150	433	351	0.430	0.581	B5MD38_HUMAN Hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=1
9	C9JE81	2.33e-124	361	175	0.369	1.000	C9JE81_HUMAN Hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta (Fragment) OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=8
10	P76503	2.35e-104	320	436	0.371	0.404	FADI_ECOLI 3-ketoacyl-CoA thiolase FadI OS=Escherichia coli (strain K12) OX=83333 GN=fadI PE=1 SV=1
11	C9JEY0	1.76e-103	306	149	0.314	1.000	C9JEY0_HUMAN Hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta (Fragment) OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=8
12	O86361	8.90e-71	233	440	0.350	0.377	O86361_MYCTU Probable acetyl-CoA acyltransferase FadA2 (3-ketoacyl-CoA thiolase) (Beta-ketothiolase) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadA2 PE=1 SV=1
13	P21775	2.16e-62	211	434	0.342	0.373	THIKA_RAT 3-ketoacyl-CoA thiolase A, peroxisomal OS=Rattus norvegicus OX=10116 GN=Acaa1a PE=1 SV=3
14	P07871	2.38e-61	208	424	0.333	0.373	THIKB_RAT 3-ketoacyl-CoA thiolase B, peroxisomal OS=Rattus norvegicus OX=10116 GN=Acaa1b PE=1 SV=2
15	Q921H8	9.55e-61	206	424	0.335	0.375	THIKA_MOUSE 3-ketoacyl-CoA thiolase A, peroxisomal OS=Mus musculus OX=10090 GN=Acaa1a PE=1 SV=1
16	Q8QZT1	2.04e-60	205	424	0.316	0.354	THIL_MOUSE Acetyl-CoA acetyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Acat1 PE=1 SV=1
17	Q8VCH0	1.16e-59	203	424	0.338	0.377	THIKB_MOUSE 3-ketoacyl-CoA thiolase B, peroxisomal OS=Mus musculus OX=10090 GN=Acaa1b PE=1 SV=1
18	A0A024R2M6	1.47e-59	203	424	0.323	0.361	A0A024R2M6_HUMAN Acetyl-Coenzyme A acyltransferase 1 (Peroxisomal 3-oxoacyl-Coenzyme A thiolase), isoform CRA_a OS=Homo sapiens OX=9606 GN=ACAA1 PE=2 SV=1
19	P09110	1.47e-59	203	424	0.323	0.361	THIK_HUMAN 3-ketoacyl-CoA thiolase, peroxisomal OS=Homo sapiens OX=9606 GN=ACAA1 PE=1 SV=2
20	P42765	3.64e-59	201	397	0.308	0.368	THIM_HUMAN 3-ketoacyl-CoA thiolase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAA2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08545 ACP_syn_III	2.8e+02	12.8	3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III
2	PF00109 ketoacyl-synt	0.00064	30.9	Beta-ketoacyl synthase, N-terminal domain
3	PF02803 Thiolase_C	6.2e-46	166.5	Thiolase, C-terminal domain
4	PF00108 Thiolase_N	1.6e-82	288.4	Thiolase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325136

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370023	0.999	Trifunctional enzyme subunit alpha, mitochondrial
2	9606.ENSP00000474560	0.994	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
3	9606.ENSP00000168216	0.990	3-hydroxyacyl-CoA dehydrogenase type-2
4	9606.ENSP00000438689	0.987	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
5	9606.ENSP00000242592	0.983	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
6	9606.ENSP00000233710	0.982	Long-chain specific acyl-CoA dehydrogenase, mitochondrial
7	9606.ENSP00000231887	0.973	Peroxisomal bifunctional enzyme
8	9606.ENSP00000357873	0.972	Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial
9	9606.ENSP00000358414	0.972	Hydroxymethylglutaryl-CoA synthase, mitochondrial
10	9606.ENSP00000322706	0.969	Hydroxymethylglutaryl-CoA synthase, cytoplasmic
11	9606.ENSP00000293217	0.959	Peroxisomal acyl-coenzyme A oxidase 1
12	9606.ENSP00000348775	0.948	Peroxisomal acyl-coenzyme A oxidase 3
13	9606.ENSP00000363614	0.944	Hydroxymethylglutaryl-CoA lyase, mitochondrial
14	9606.ENSP00000365462	0.940	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA (PubMed:8434582, PubMed:6765947, PubMed:10101253). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, [...]
15	9606.ENSP00000426638	0.940	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
16	9606.ENSP00000265838	0.938	Acetyl-CoA acetyltransferase, mitochondrial
17	9606.ENSP00000381654	0.936	3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic
18	9606.ENSP00000419027	0.936	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA . Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then transfers the carboxy [...]
19	9606.ENSP00000263702	0.930	Enoyl-[acyl-carrier-protein] reductase, mitochondrial
20	9606.ENSP00000359871	0.927	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003988	1.000	acetyl-CoA C-acyltransferase activity
GO:0005515	0.998	protein binding
GO:0097159	0.972	organic cyclic compound binding
GO:1901363	0.971	heterocyclic compound binding
GO:0016491	0.694	oxidoreductase activity
GO:0003676	0.624	nucleic acid binding
GO:0003723	0.589	RNA binding
GO:0016453	0.538	C-acetyltransferase activity
GO:0016836	0.381	hydro-lyase activity
GO:0004300	0.368	enoyl-CoA hydratase activity
GO:0016614	0.363	oxidoreductase activity, acting on CH-OH group of donors
GO:0016616	0.354	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0003857	0.344	3-hydroxyacyl-CoA dehydrogenase activity
GO:0003985	0.302	acetyl-CoA C-acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019395	0.995	fatty acid oxidation
GO:0006635	0.988	fatty acid beta-oxidation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0032991	0.980	protein-containing complex
GO:0016020	0.976	membrane
GO:0005759	0.902	mitochondrial matrix
GO:0031090	0.892	organelle membrane
GO:1902494	0.740	catalytic complex
GO:0031967	0.662	organelle envelope
GO:0005740	0.654	mitochondrial envelope
GO:0031966	0.567	mitochondrial membrane
GO:0098798	0.345	mitochondrial protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21564	1.000	acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA
EC:2.3.1.16	1.000	acetyl-CoA C-acyltransferase.
EC:1.-.-.-	0.694	Oxidoreductases.
EC:4.2.1.-	0.381	Hydro-lyases.
RHEA:16105	0.368	a (3S)-3-hydroxyacyl-CoA = a (2E)-enoyl-CoA + H2O
EC:4.2.1.17	0.368	enoyl-CoA hydratase.
EC:1.1.-.-	0.363	Acting on the CH-OH group of donors.
EC:1.1.1.-	0.354	With NAD(+) or NADP(+) as acceptor.
RHEA:22432	0.344	a (3S)-3-hydroxyacyl-CoA + NAD(+) = a 3-oxoacyl-CoA + H(+) + NADH
EC:1.1.1.35	0.344	3-hydroxyacyl-CoA dehydrogenase.
RHEA:21036	0.302	2 acetyl-CoA = acetoacetyl-CoA + CoA
EC:2.3.1.9	0.302	acetyl-CoA C-acetyltransferase.

[back to server]