StarFunc result for job id P55103

User Input

>input (352 residues)
MTSSLLLAFLLLAPTTVATPRAGGQCPACGGPTLELESQRELLLDLAKRSILDKLHLTQR
PTLNRPVSRAALRTALQHLHGVPQGALLEDNREQECEIISFAETGLSTINQTRLDFHFSS
DRTAGDREVQQASLMFFVQLPSNTTWTLKVRVLVLGPHNTNLTLATQYLLEVDASGWHQL
PLGPEAQAACSQGHLTLELVLEGQVAQSSVILGGAAHRPFVAARVRVGGKHQIHRRGIDC
QGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLN
LLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55103	1.000	1.000	3.796E-69	352	1.000	1.000	P55103.pdb.gz	INHBC_HUMAN Inhibin beta C chain OS=Homo sapiens OX=9606 GN=INHBC PE=2 SV=1
2	AFDB:P58166	0.464	0.467	3.587E-33	350	0.412	0.414	P58166.pdb.gz	INHBE_HUMAN Inhibin beta E chain OS=Homo sapiens OX=9606 GN=INHBE PE=1 SV=1
3	AFDB:Q91350	0.449	0.428	5.155E-31	370	0.389	0.370	Q91350.pdb.gz	Q91350_XENLA Inhibin beta B chain OS=Xenopus laevis OX=8355 GN=inhbb.L PE=2 SV=1
4	AFDB:P17491	0.457	0.395	1.989E-30	411	0.389	0.333	P17491.pdb.gz	INHBB_RAT Inhibin beta B chain OS=Rattus norvegicus OX=10116 GN=Inhbb PE=2 SV=2
5	AFDB:P27093	0.437	0.396	2.215E-30	391	0.384	0.345	P27093.pdb.gz	INHBB_CHICK Inhibin beta B chain OS=Gallus gallus OX=9031 GN=INHBB PE=2 SV=2
6	AFDB:A4D1W7	0.461	0.386	2.566E-28	426	0.372	0.308	A4D1W7.pdb.gz	A4D1W7_HUMAN Inhibin beta A chain OS=Homo sapiens OX=9606 GN=INHBA PE=1 SV=1
7	AFDB:Q8QGE3	0.442	0.397	4.253E-27	395	0.347	0.309	Q8QGE3.pdb.gz	Q8QGE3_DANRE Activin beta A subunit OS=Danio rerio OX=7955 GN=actba PE=2 SV=1
8	PDB:5hlyA	0.363	0.417	1.833E-22	299	0.307	0.361	5hlyA.pdb.gz
9	AFDB:Q9VQG9	0.438	0.271	3.578E-22	586	0.219	0.131	Q9VQG9.pdb.gz	Q9VQG9_DROME Dawdle, isoform A OS=Drosophila melanogaster OX=7227 GN=daw PE=2 SV=1
10	AFDB:A0A0B5GTK3	0.331	0.304	5.324E-21	386	0.264	0.241	A0A0B5GTK3.pdb.gz
11	AFDB:A0A024RB20	0.356	0.313	8.201E-21	407	0.298	0.258	A0A024RB20.pdb.gz
12	PDB:5ntuA	0.367	0.408	3.284E-17	308	0.233	0.266	5ntuA.pdb.gz
13	PDB:5nxsA	0.393	0.450	4.015E-15	290	0.227	0.276	5nxsA.pdb.gz
14	PDB:6umxA	0.287	0.337	2.141E-14	279	0.213	0.269	6umxA.pdb.gz
15	PDB:5vqfB	0.288	0.308	2.385E-14	320	0.190	0.209	5vqfB.pdb.gz
16	PDB:3rjrC	0.280	0.285	2.657E-14	343	0.205	0.210	3rjrC.pdb.gz
17	PDB:5ffoG	0.278	0.321	2.349E-12	297	0.170	0.202	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
18	PDB:7y1rB	0.266	0.295	3.429E-12	308	0.185	0.211	7y1rB.pdb.gz
19	PDB:5nxsB	0.327	0.417	5.102E-11	251	0.182	0.255	5nxsB.pdb.gz
20	PDB:7qe7L	0.184	0.309	1.464E-3	183	0.071	0.137	7qe7L.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P55103	0.0	723	352	1.000	1.000	INHBC_HUMAN Inhibin beta C chain OS=Homo sapiens OX=9606 GN=INHBC PE=2 SV=1
2	P58166	1.41e-78	246	350	0.429	0.431	INHBE_HUMAN Inhibin beta E chain OS=Homo sapiens OX=9606 GN=INHBE PE=1 SV=1
3	Q91350	3.83e-70	225	370	0.378	0.359	Q91350_XENLA Inhibin beta B chain OS=Xenopus laevis OX=8355 GN=inhbb.L PE=2 SV=1
4	P27093	7.98e-70	225	391	0.355	0.320	INHBB_CHICK Inhibin beta B chain OS=Gallus gallus OX=9031 GN=INHBB PE=2 SV=2
5	P09529	4.36e-69	223	407	0.378	0.327	INHBB_HUMAN Inhibin beta B chain OS=Homo sapiens OX=9606 GN=INHBB PE=1 SV=2
6	P17491	3.64e-68	221	411	0.361	0.309	INHBB_RAT Inhibin beta B chain OS=Rattus norvegicus OX=10116 GN=Inhbb PE=2 SV=2
7	Q04999	3.96e-68	221	411	0.361	0.309	INHBB_MOUSE Inhibin beta B chain OS=Mus musculus OX=10090 GN=Inhbb PE=2 SV=4
8	P18331	8.45e-63	207	424	0.381	0.316	INHBA_RAT Inhibin beta A chain OS=Rattus norvegicus OX=10116 GN=Inhba PE=2 SV=1
9	Q04998	2.61e-62	206	424	0.384	0.318	INHBA_MOUSE Inhibin beta A chain OS=Mus musculus OX=10090 GN=Inhba PE=1 SV=1
10	Q8QGE3	1.37e-61	204	395	0.347	0.309	Q8QGE3_DANRE Activin beta A subunit OS=Danio rerio OX=7955 GN=actba PE=2 SV=1
11	P07995	1.75e-61	204	425	0.364	0.301	INHBA_BOVIN Inhibin beta A chain OS=Bos taurus OX=9913 GN=INHBA PE=1 SV=2
12	A4D1W7	2.63e-61	204	426	0.375	0.310	A4D1W7_HUMAN Inhibin beta A chain OS=Homo sapiens OX=9606 GN=INHBA PE=1 SV=1
13	P08476	2.63e-61	204	426	0.375	0.310	INHBA_HUMAN Inhibin beta A chain OS=Homo sapiens OX=9606 GN=INHBA PE=1 SV=2
14	Q5I3Q2	8.21e-25	105	376	0.290	0.271	GDF8_EPICO Growth/differentiation factor 8 OS=Epinephelus coioides OX=94232 GN=gdf-8 PE=1 SV=1
15	P49001	4.66e-24	103	393	0.270	0.242	BMP2_RAT Bone morphogenetic protein 2 OS=Rattus norvegicus OX=10116 GN=Bmp2 PE=2 SV=1
16	Q9Z217	5.51e-24	103	405	0.298	0.259	GDF11_RAT Growth/differentiation factor 11 OS=Rattus norvegicus OX=10116 GN=Gdf11 PE=2 SV=2
17	Q9Z1W4	7.18e-24	103	405	0.295	0.257	GDF11_MOUSE Growth/differentiation factor 11 OS=Mus musculus OX=10090 GN=Gdf11 PE=1 SV=1
18	P21274	8.83e-24	103	394	0.267	0.239	BMP2_MOUSE Bone morphogenetic protein 2 OS=Mus musculus OX=10090 GN=Bmp2 PE=1 SV=3
19	H0YI30	1.72e-23	102	380	0.293	0.271	H0YI30_HUMAN Growth differentiation factor 11 (Fragment) OS=Homo sapiens OX=9606 GN=GDF11 PE=1 SV=1
20	O95390	1.80e-23	102	407	0.295	0.256	GDF11_HUMAN Growth/differentiation factor 11 OS=Homo sapiens OX=9606 GN=GDF11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15777 Anti-TRAP	87	14.5	Tryptophan RNA-binding attenuator protein inhibitory protein
2	PF00019 TGF_beta	7e-25	99.3	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308716

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000416606	0.900	Follitropin subunit beta
2	9606.ENSP00000482232	0.900	Glycoprotein hormones, alpha polypeptide
3	9606.ENSP00000340361	0.891	Activin receptor type-2B
4	9606.ENSP00000241416	0.888	Activin receptor type-2A
5	9606.ENSP00000256759	0.874	Follistatin
6	9606.ENSP00000287139	0.818	Nodal homolog
7	9606.ENSP00000238682	0.815	Transforming growth factor beta-3
8	9606.ENSP00000221930	0.806	Transforming growth factor beta-1
9	9606.ENSP00000243786	0.799	Inhibin alpha chain
10	9606.ENSP00000317903	0.783	R3H domain containing 2
11	9606.ENSP00000243349	0.758	Activin receptor type-1C
12	9606.ENSP00000244527	0.601	Sodium-dependent phosphate transport protein 1
13	9606.ENSP00000301891	0.567	Solute carrier family 22 member 11
14	9606.ENSP00000264784	0.557	Solute carrier family 2, facilitated glucose transporter member 9
15	9606.ENSP00000442656	0.538	Activin receptor type-1B
16	9606.ENSP00000263640	0.522	Activin receptor type-1
17	9606.ENSP00000405812	0.520	Electroneutral sodium bicarbonate exchanger 1
18	9606.ENSP00000337722	0.515	ADP-ribosylation factor-like protein 6
19	9606.ENSP00000394485	0.513	Na(+)/H(+) exchange regulatory cofactor NHE-RF3
20	9606.ENSP00000426548	0.513	BTB/POZ domain-containing protein KCTD16

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005160	0.999	transforming growth factor beta receptor binding
GO:0098772	0.614	molecular function regulator activity
GO:0030545	0.594	signaling receptor regulator activity
GO:0030546	0.485	signaling receptor activator activity
GO:0048018	0.483	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.984	response to stimulus
GO:0032501	0.938	multicellular organismal process
GO:0048856	0.934	anatomical structure development
GO:0048518	0.926	positive regulation of biological process
GO:0023051	0.807	regulation of signaling
GO:0048522	0.801	positive regulation of cellular process
GO:0048523	0.786	negative regulation of cellular process
GO:0007275	0.741	multicellular organism development
GO:0019222	0.700	regulation of metabolic process
GO:0051716	0.651	cellular response to stimulus
GO:0060255	0.623	regulation of macromolecule metabolic process
GO:0007154	0.621	cell communication
GO:0010646	0.618	regulation of cell communication
GO:0080090	0.554	regulation of primary metabolic process
GO:0007178	0.552	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0008152	0.549	metabolic process
GO:0051239	0.503	regulation of multicellular organismal process
GO:0048583	0.473	regulation of response to stimulus
GO:0010468	0.458	regulation of gene expression
GO:0071704	0.446	organic substance metabolic process
GO:0051171	0.445	regulation of nitrogen compound metabolic process
GO:0031323	0.445	regulation of cellular metabolic process
GO:0009966	0.440	regulation of signal transduction
GO:0050793	0.419	regulation of developmental process
GO:0009893	0.403	positive regulation of metabolic process
GO:0009889	0.387	regulation of biosynthetic process
GO:0048513	0.383	animal organ development
GO:0010556	0.381	regulation of macromolecule biosynthetic process
GO:0051252	0.381	regulation of RNA metabolic process
GO:0031326	0.380	regulation of cellular biosynthetic process
GO:0023056	0.379	positive regulation of signaling
GO:0010647	0.379	positive regulation of cell communication
GO:0044237	0.378	cellular metabolic process
GO:0051240	0.365	positive regulation of multicellular organismal process
GO:0048731	0.359	system development
GO:2001141	0.355	regulation of RNA biosynthetic process
GO:0071363	0.354	cellular response to growth factor stimulus
GO:0010604	0.341	positive regulation of macromolecule metabolic process
GO:0006355	0.339	regulation of DNA-templated transcription
GO:0051094	0.325	positive regulation of developmental process
GO:0044238	0.318	primary metabolic process
GO:0048584	0.309	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0071944	0.941	cell periphery
GO:0005622	0.737	intracellular anatomical structure
GO:0005737	0.555	cytoplasm
GO:0005615	0.513	extracellular space
GO:0005886	0.509	plasma membrane
GO:0032991	0.324	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]