StarFunc result for job id P55107

User Input

>input (478 residues)
MAHVPARTSPGPGPQLLLLLLPLFLLLLRDVAGSHRAPAWSALPAAADGLQGDRDLQRHP
GDAAATLGPSAQDMVAVHMHRLYEKYSRQGARPGGGNTVRSFRARLEVVDQKAVYFFNLT
SMQDSEMILTATFHFYSEPPRWPRALEVLCKPRAKNASGRPLPLGPPTRQHLLFRSLSQN
TATQGLLRGAMALAPPPRGLWQAKDISPIVKAARRDGELLLSAQLDSEERDPGVPRPSPY
APYILVYANDLAISEPNSVAVTLQRYDPFPAGDPEPRAAPNNSADPRVRRAAQATGPLQD
NELPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRKKGQEVFMAASQVLDFDEK
TMQKARRKQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPS
NHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55107	1.000	1.000	6.071E-87	478	1.000	1.000	P55107.pdb.gz	GDF10_HUMAN Growth/differentiation factor 10 OS=Homo sapiens OX=9606 GN=GDF10 PE=2 SV=1
2	AFDB:P55108	0.719	0.722	3.641E-72	476	0.835	0.838	P55108.pdb.gz	GDF10_RAT Growth/differentiation factor 10 OS=Rattus norvegicus OX=10116 GN=Gdf10 PE=2 SV=1
3	AFDB:P12645	0.612	0.619	2.352E-44	472	0.448	0.453	P12645.pdb.gz	BMP3_HUMAN Bone morphogenetic protein 3 OS=Homo sapiens OX=9606 GN=BMP3 PE=1 SV=2
4	AFDB:Q7T2X6	0.634	0.681	3.273E-44	443	0.452	0.488	Q7T2X6.pdb.gz	GDF10_XENLA Growth/differentiation factor 10 OS=Xenopus laevis OX=8355 GN=gdf10 PE=1 SV=1
5	AFDB:P49002	0.615	0.627	5.481E-42	468	0.452	0.462	P49002.pdb.gz	BMP3_RAT Bone morphogenetic protein 3 OS=Rattus norvegicus OX=10116 GN=Bmp3 PE=2 SV=1
6	AFDB:A0JML2	0.626	0.659	6.119E-42	452	0.414	0.438	A0JML2.pdb.gz	A0JML2_DANRE Bone morphogenetic protein 3 OS=Danio rerio OX=7955 GN=zgc:153939 PE=2 SV=1
7	AFDB:P43029	0.491	0.508	8.944E-26	461	0.211	0.219	P43029.pdb.gz	GDF7_MOUSE Growth/differentiation factor 7 OS=Mus musculus OX=10090 GN=Gdf7 PE=2 SV=2
8	AFDB:Q7Z4P5	0.480	0.507	8.549E-25	450	0.205	0.218	Q7Z4P5.pdb.gz	GDF7_HUMAN Growth/differentiation factor 7 OS=Homo sapiens OX=9606 GN=GDF7 PE=2 SV=2
9	AFDB:A0A0B5GNT7	0.454	0.514	1.567E-24	416	0.215	0.248	A0A0B5GNT7.pdb.gz
10	AFDB:F1R5Z7	0.444	0.533	1.417E-23	391	0.226	0.276	F1R5Z7.pdb.gz
11	PDB:5ntuA	0.226	0.323	2.751E-11	308	0.151	0.234	5ntuA.pdb.gz
12	PDB:5hlyA	0.255	0.379	1.890E-10	299	0.113	0.181	5hlyA.pdb.gz
13	PDB:6umxA	0.235	0.356	1.997E-10	279	0.138	0.237	6umxA.pdb.gz
14	PDB:5nxsA	0.200	0.300	3.463E-10	290	0.136	0.224	5nxsA.pdb.gz
15	PDB:5vqfB	0.219	0.309	7.084E-10	320	0.130	0.194	5vqfB.pdb.gz
16	PDB:3rjrC	0.199	0.264	1.100E-9	343	0.128	0.178	3rjrC.pdb.gz
17	PDB:5ffoG	0.231	0.344	6.065E-9	297	0.132	0.212	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
18	PDB:7y1rB	0.202	0.290	1.399E-7	308	0.134	0.208	7y1rB.pdb.gz
19	PDB:5nxsB	0.182	0.328	3.770E-7	251	0.123	0.235	5nxsB.pdb.gz
20	PDB:6q2sA	0.144	0.528	1.036E-4	98	0.050	0.245	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P55107	0.0	977	478	1.000	1.000	GDF10_HUMAN Growth/differentiation factor 10 OS=Homo sapiens OX=9606 GN=GDF10 PE=2 SV=1
2	P55108	0.0	788	476	0.805	0.809	GDF10_RAT Growth/differentiation factor 10 OS=Rattus norvegicus OX=10116 GN=Gdf10 PE=2 SV=1
3	P97737	0.0	786	476	0.803	0.807	GDF10_MOUSE Growth/differentiation factor 10 OS=Mus musculus OX=10090 GN=Gdf10 PE=1 SV=2
4	Q7T2X6	6.98e-137	403	443	0.452	0.488	GDF10_XENLA Growth/differentiation factor 10 OS=Xenopus laevis OX=8355 GN=gdf10 PE=1 SV=1
5	A0JML2	1.52e-113	344	452	0.429	0.454	A0JML2_DANRE Bone morphogenetic protein 3 OS=Danio rerio OX=7955 GN=zgc:153939 PE=2 SV=1
6	P12645	2.54e-113	344	472	0.448	0.453	BMP3_HUMAN Bone morphogenetic protein 3 OS=Homo sapiens OX=9606 GN=BMP3 PE=1 SV=2
7	Q8BHE5	4.15e-111	338	468	0.435	0.444	BMP3_MOUSE Bone morphogenetic protein 3 OS=Mus musculus OX=10090 GN=Bmp3 PE=1 SV=1
8	P49002	6.55e-108	330	468	0.448	0.457	BMP3_RAT Bone morphogenetic protein 3 OS=Rattus norvegicus OX=10116 GN=Bmp3 PE=2 SV=1
9	Q8UVQ2	2.43e-34	134	391	0.117	0.143	Q8UVQ2_DANRE Anti-dorsalizing morphogenetic protein OS=Danio rerio OX=7955 GN=wu:fe05b04 PE=2 SV=1
10	O93369	1.92e-29	121	411	0.107	0.124	O93369_DANRE Bone morphogenetic protein 2 OS=Danio rerio OX=7955 GN=BMP2b PE=2 SV=1
11	O57574	7.61e-29	119	400	0.105	0.125	O57574_DANRE Bone morphogenetic protein 4 OS=Danio rerio OX=7955 GN=zBMP-4 PE=2 SV=1
12	P49001	1.05e-28	119	393	0.098	0.120	BMP2_RAT Bone morphogenetic protein 2 OS=Rattus norvegicus OX=10116 GN=Bmp2 PE=2 SV=1
13	C8C060	1.11e-28	119	396	0.098	0.119	C8C060_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=3 SV=1
14	P12643	1.11e-28	119	396	0.098	0.119	BMP2_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=1 SV=1
15	P21274	1.30e-28	119	394	0.098	0.119	BMP2_MOUSE Bone morphogenetic protein 2 OS=Mus musculus OX=10090 GN=Bmp2 PE=1 SV=3
16	D2TEB7	1.39e-28	119	416	0.107	0.123	D2TEB7_DANRE Bone morphogenetic protein 16 OS=Danio rerio OX=7955 GN=bmp16 PE=2 SV=1
17	Q90751	1.43e-28	117	353	0.105	0.142	BMP2_CHICK Bone morphogenetic protein 2 (Fragment) OS=Gallus gallus OX=9031 GN=BMP2 PE=2 SV=1
18	P12644	2.22e-28	118	408	0.105	0.123	BMP4_HUMAN Bone morphogenetic protein 4 OS=Homo sapiens OX=9606 GN=BMP4 PE=1 SV=1
19	P21275	6.64e-28	117	408	0.103	0.120	BMP4_MOUSE Bone morphogenetic protein 4 OS=Mus musculus OX=10090 GN=Bmp4 PE=1 SV=2
20	Q06826	8.07e-28	117	408	0.103	0.120	BMP4_RAT Bone morphogenetic protein 4 OS=Rattus norvegicus OX=10116 GN=Bmp4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00019 TGF_beta	1e-25	101.9	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000464145

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000241416	0.890	Activin receptor type-2A
2	9606.ENSP00000382485	0.677	Opiorphin prepropeptide
3	9606.ENSP00000377372	0.616	Neuromodulin
4	9606.ENSP00000305714	0.550	Bone morphogenetic protein 1
5	9606.ENSP00000247271	0.535	Oligodendrocyte-myelin glycoprotein
6	9606.ENSP00000401907	0.530	Bone morphogenetic protein receptor type-1B
7	9606.ENSP00000442656	0.516	Activin receptor type-1B
8	9606.ENSP00000376048	0.511	Myelin-associated glycoprotein
9	9606.ENSP00000262160	0.510	Mothers against decapentaplegic homolog 2
10	9606.ENSP00000376141	0.504	Major facilitator superfamily domain containing 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	1.000	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0032502	0.988	developmental process
GO:0032501	0.987	multicellular organismal process
GO:0050896	0.984	response to stimulus
GO:0048856	0.984	anatomical structure development
GO:0007275	0.935	multicellular organism development
GO:0048518	0.932	positive regulation of biological process
GO:0070848	0.924	response to growth factor
GO:0007178	0.906	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0050793	0.898	regulation of developmental process
GO:0045667	0.892	regulation of osteoblast differentiation
GO:0019222	0.891	regulation of metabolic process
GO:0071363	0.889	cellular response to growth factor stimulus
GO:0048731	0.876	system development
GO:0060255	0.865	regulation of macromolecule metabolic process
GO:0071559	0.856	response to transforming growth factor beta
GO:0080090	0.853	regulation of primary metabolic process
GO:0051171	0.853	regulation of nitrogen compound metabolic process
GO:0048522	0.848	positive regulation of cellular process
GO:0071560	0.838	cellular response to transforming growth factor beta stimulus
GO:0031323	0.821	regulation of cellular metabolic process
GO:0001501	0.725	skeletal system development
GO:0048519	0.677	negative regulation of biological process
GO:0023051	0.667	regulation of signaling
GO:0010646	0.664	regulation of cell communication
GO:0048523	0.637	negative regulation of cellular process
GO:0048513	0.596	animal organ development
GO:0010604	0.560	positive regulation of macromolecule metabolic process
GO:0010468	0.518	regulation of gene expression
GO:0051173	0.479	positive regulation of nitrogen compound metabolic process
GO:0048583	0.475	regulation of response to stimulus
GO:0051246	0.474	regulation of protein metabolic process
GO:0031325	0.461	positive regulation of cellular metabolic process
GO:0009966	0.460	regulation of signal transduction
GO:0031399	0.438	regulation of protein modification process
GO:0051239	0.433	regulation of multicellular organismal process
GO:0010556	0.365	regulation of macromolecule biosynthetic process
GO:0031326	0.365	regulation of cellular biosynthetic process
GO:0051252	0.362	regulation of RNA metabolic process
GO:0006355	0.347	regulation of DNA-templated transcription
GO:0030154	0.338	cell differentiation
GO:0007179	0.326	transforming growth factor beta receptor signaling pathway
GO:0090092	0.317	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005576	0.993	extracellular region
GO:0071944	0.990	cell periphery
GO:0043227	0.735	membrane-bounded organelle
GO:0030312	0.707	external encapsulating structure
GO:0031012	0.687	extracellular matrix
GO:0005615	0.653	extracellular space
GO:0062023	0.650	collagen-containing extracellular matrix
GO:0016020	0.629	membrane
GO:0005737	0.365	cytoplasm
GO:0043231	0.336	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]