StarFunc result for job id P55157

User Input

>input (894 residues)
MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGKLQDSVGYRIS
SNVDVALLWRNPDGDDDQLIQITMKDVNVENVNQQRGEKSIFKGKSPSKIMGKENLEALQ
RPTLLHLIHGKVKEFYSYQNEAVAIENIKRGLASLFQTQLSSGTTNEVDISGNCKVTYQA
HQDKVIKIKALDSCKIARSGFTTPNQVLGVSSKATSVTTYKIEDSFVIAVLAEETHNFGL
NFLQTIKGKIVSKQKLELKTTEAGPRLMSGKQAAAIIKAVDSKYTAIPIVGQVFQSHCKG
CPSLSELWRSTRKYLQPDNLSKAEAVRNFLAFIQHLRTAKKEEILQILKMENKEVLPQLV
DAVTSAQTSDSLEAILDFLDFKSDSSIILQERFLYACGFASHPNEELLRALISKFKGSIG
SSDIRETVMIITGTLVRKLCQNEGCKLKAVVEAKKLILGGLEKAEKKEDTRMYLLALKNA
LLPEGIPSLLKYAEAGEGPISHLATTALQRYDLPFITDEVKKTLNRIYHQNRKVHEKTVR
TAAAAIILNNNPSYMDVKNILLSIGELPQEMNKYMLAIVQDILRFEMPASKIVRRVLKEM
VAHNYDRFSRSGSSSAYTGYIERSPRSASTYSLDILYSGSGILRRSNLNIFQYIGKAGLH
GSQVVIEAQGLEALIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSDLMSKMLSA
SGDPISVVKGLILLIDHSQELQLQSGLKANIEVQGGLAIDISGAMEFSLWYRESKTRVKN
RVTVVITTDITVDSSFVKAGLETSTETEAGLEFISTVQFSQYPFLVCMQMDKDEAPFRQF
EKKYERLSTGRGYVSQKRKESVLAGCEFPLHQENSEMCKVVFAPQPDSTSSGWF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6i7sG	0.936	0.969	0.000	863	0.965	1.000	6i7sG.pdb.gz	The crystal structure of human microsomal triglyceride transfer protein.
2	AFDB:A0A0R4IVV0	0.956	0.966	0.000	884	0.536	0.542	A0A0R4IVV0.pdb.gz	MTP_DANRE Microsomal triglyceride transfer protein large subunit OS=Danio rerio OX=7955 GN=mttp PE=1 SV=1
3	AFDB:D4A1W8	0.960	0.957	0.000	896	0.846	0.844	D4A1W8.pdb.gz	MTP_RAT Microsomal triglyceride transfer protein large subunit OS=Rattus norvegicus OX=10116 GN=Mttp PE=1 SV=1
4	AFDB:P55156	0.962	0.970	0.000	887	0.857	0.864	P55156.pdb.gz	MTP_BOVIN Microsomal triglyceride transfer protein large subunit (Fragment) OS=Bos taurus OX=9913 GN=MTTP PE=1 SV=1
5	AFDB:P55157	1.000	1.000	0.000	894	1.000	1.000	P55157.pdb.gz	MTP_HUMAN Microsomal triglyceride transfer protein large subunit OS=Homo sapiens OX=9606 GN=MTTP PE=1 SV=1
6	AFDB:Q9VIH3	0.856	0.863	4.103E-60	886	0.235	0.237	Q9VIH3.pdb.gz	MTP_DROME Microsomal triacylglycerol transfer protein OS=Drosophila melanogaster OX=7227 GN=Mtp PE=1 SV=2
7	AFDB:G5ECG7	0.794	0.796	1.397E-43	892	0.152	0.152	G5ECG7.pdb.gz	MTP_CAEEL Microsomal triglyceride transfer protein homolog OS=Caenorhabditis elegans OX=6239 GN=dsc-4 PE=1 SV=1
8	AFDB:Q92093	0.578	0.343	1.427E-35	1659	0.160	0.086	Q92093.pdb.gz	VIT_ONCMY Vitellogenin OS=Oncorhynchus mykiss OX=8022 GN=vtg1 PE=1 SV=1
9	AFDB:Q1MTC4	0.590	0.354	4.083E-35	1631	0.148	0.081	Q1MTC4.pdb.gz	Q1MTC4_DANRE Vitellogenin 2 OS=Danio rerio OX=7955 GN=si:dkey-4c23.2 PE=1 SV=1
10	AFDB:Q1LWN2	0.584	0.408	7.540E-35	1362	0.162	0.106	Q1LWN2.pdb.gz	Q1LWN2_DANRE Vitellogenin 1 OS=Danio rerio OX=7955 GN=vg1 PE=1 SV=1
11	AFDB:P05690	0.619	0.372	6.450E-34	1613	0.140	0.077	P05690.pdb.gz	VIT2_CAEEL Vitellogenin-2 OS=Caenorhabditis elegans OX=6239 GN=vit-2 PE=1 SV=5
12	PDB:4o9yA	0.093	0.045	4.267E-4	2490	0.110	0.039	4o9yA.pdb.gz
13	PDB:5wbjA	0.189	0.166	4.866E-4	1058	0.070	0.060	5wbjA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
14	PDB:6bcuW	0.183	0.162	6.328E-4	1052	0.097	0.083	6bcuW.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
15	PDB:4mmhA	0.109	0.134	1.392E-3	637	0.078	0.110	4mmhA.pdb.gz	Crystal Structure of Pedobacter heparinus Heparin Lyase Hep III with the Active Site in a Deep Cleft
16	PDB:1oyzA	0.199	0.506	1.455E-3	273	0.046	0.150	1oyzA.pdb.gz
17	PDB:4d4zB	0.123	0.305	1.659E-3	290	0.051	0.159	4d4zB.pdb.gz	Crystal Structure of the Peroxo-Diiron(III) Intermediate of Deoxyhypusine Hydroxylase, an Oxygenase Involved in Hypusination.
18	PDB:6u62A	0.155	0.133	3.493E-3	1110	0.085	0.068	6u62A.pdb.gz	Structural basis for the docking of mTORC1 on the lysosomal surface.
19	PDB:4tnmA	0.173	0.314	3.650E-3	407	0.060	0.133	4tnmA.pdb.gz
20	PDB:4xo4A	0.192	0.197	4.960E-3	870	0.054	0.055	4xo4A.pdb.gz	Crystal Structure of E. coli Aminopeptidase N in complex with L-Methionine

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IVV0	0.0	1010	884	0.543	0.549	MTP_DANRE Microsomal triglyceride transfer protein large subunit OS=Danio rerio OX=7955 GN=mttp PE=1 SV=1
2	D4A1W8	0.0	1608	896	0.860	0.858	MTP_RAT Microsomal triglyceride transfer protein large subunit OS=Rattus norvegicus OX=10116 GN=Mttp PE=1 SV=1
3	E9PBP6	0.0	1673	811	0.907	1.000	E9PBP6_HUMAN Microsomal triglyceride transfer protein large subunit OS=Homo sapiens OX=9606 GN=MTTP PE=1 SV=2
4	O08601	0.0	1604	894	0.859	0.859	MTP_MOUSE Microsomal triglyceride transfer protein large subunit OS=Mus musculus OX=10090 GN=Mttp PE=1 SV=2
5	P55156	0.0	1611	887	0.860	0.867	MTP_BOVIN Microsomal triglyceride transfer protein large subunit (Fragment) OS=Bos taurus OX=9913 GN=MTTP PE=1 SV=1
6	P55157	0.0	1844	894	1.000	1.000	MTP_HUMAN Microsomal triglyceride transfer protein large subunit OS=Homo sapiens OX=9606 GN=MTTP PE=1 SV=1
7	Q9VIH3	3.65e-58	217	886	0.256	0.258	MTP_DROME Microsomal triacylglycerol transfer protein OS=Drosophila melanogaster OX=7227 GN=Mtp PE=1 SV=2
8	Q6RG02	0.028	40.8	2586	0.034	0.012	VIT_PENME Vitellogenin OS=Penaeus merguiensis OX=71412 PE=1 SV=2
9	Q820Q2	0.20	35.8	146	0.026	0.158	Q820Q2_NITEU Ferric uptake regulation protein OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=fur1 PE=3 SV=1
10	G5ECG7	0.36	37.0	892	0.021	0.021	MTP_CAEEL Microsomal triglyceride transfer protein homolog OS=Caenorhabditis elegans OX=6239 GN=dsc-4 PE=1 SV=1
11	Q7KTG2	0.36	37.4	4333	0.027	0.006	Q7KTG2_DROME Apolipoprotein lipid transfer particle OS=Drosophila melanogaster OX=7227 GN=Apoltp PE=1 SV=2
12	P18948	3.6	33.9	1651	0.032	0.018	VIT6_CAEEL Vitellogenin-6 OS=Caenorhabditis elegans OX=6239 GN=vit-6 PE=1 SV=5
13	Q92093	3.7	33.9	1659	0.057	0.031	VIT_ONCMY Vitellogenin OS=Oncorhynchus mykiss OX=8022 GN=vtg1 PE=1 SV=1
14	Q9C0X8	7.8	32.7	1163	0.026	0.020	RRP12_SCHPO Putative ribosomal RNA-processing protein 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrp12 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19482 DUF6018	3.9e+02	12.4	Family of unknown function (DUF6018)
2	PF19444 MTP_lip_bd	6.4e-154	523.3	MTP large subunit, lipid-binding domain
3	PF01347 Vitellogenin_N	1.5e-73	259.9	Lipoprotein amino terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003829983.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008950774.1	0.984	Apolipoprotein B-100
2	9597.XP_003831156.1	0.975	Prolyl 4-hydroxylase subunit beta
3	9597.XP_003820129.1	0.856	Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility (By similarity)
4	9597.XP_008958608.1	0.849	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 47% coverage of the annotated genomic feature by RNAseq alignments
5	9597.XP_008958663.1	0.849	Uncharacterized protein LOC100990090
6	9597.XP_008972206.1	0.841	Protein disulfide isomerase family A member 4
7	9597.XP_003811880.1	0.824	May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism
8	9597.XP_003814998.1	0.819	Protein disulfide isomerase family A member 3
9	9597.XP_003820134.1	0.758	Apolipoprotein A-IV
10	9597.XP_008958603.1	0.721	Thioredoxin domain-containing protein 11 isoform X1
11	9597.XP_008959866.1	0.721	Protein disulfide isomerase family A member 2
12	9597.XP_003819477.1	0.664	Diacylglycerol O-acyltransferase 1 isoform X1
13	9597.XP_003820132.1	0.620	Apolipoprotein C3
14	9597.XP_003817593.1	0.618	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 1884 ESTs, 17 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns
15	9597.XP_003819624.1	0.599	Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.
16	9597.XP_003812430.1	0.583	Peroxisome proliferator activated receptor alpha
17	9597.XP_003805902.1	0.581	Fatty acid binding protein 1
18	9597.XP_008967169.1	0.568	NPC1 like intracellular cholesterol transporter 1
19	9597.XP_003829985.1	0.566	DnaJ heat shock protein family (Hsp40) member B14
20	9597.XP_003814755.1	0.553	Diacylglycerol O-acyltransferase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140344	1.000	triglyceride transfer activity
GO:1904121	1.000	phosphatidylethanolamine transfer activity
GO:0120020	1.000	cholesterol transfer activity
GO:0008525	0.947	phosphatidylcholine transporter activity
GO:0120019	0.819	phosphatidylcholine transfer activity
GO:0046983	0.321	protein dimerization activity
GO:0046624	0.309	sphingolipid transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0009987	0.990	cellular process
GO:0050789	0.982	regulation of biological process
GO:0006629	0.982	lipid metabolic process
GO:0033036	0.974	macromolecule localization
GO:0071702	0.965	organic substance transport
GO:1901564	0.954	organonitrogen compound metabolic process
GO:0010876	0.953	lipid localization
GO:0006869	0.932	lipid transport
GO:0032501	0.916	multicellular organismal process
GO:0097006	0.906	regulation of plasma lipoprotein particle levels
GO:0043170	0.884	macromolecule metabolic process
GO:0071827	0.845	plasma lipoprotein particle organization
GO:0044237	0.818	cellular metabolic process
GO:0019538	0.808	protein metabolic process
GO:0051641	0.807	cellular localization
GO:0008104	0.765	protein localization
GO:0015031	0.762	protein transport
GO:0042592	0.700	homeostatic process
GO:0050896	0.561	response to stimulus
GO:0048878	0.536	chemical homeostasis
GO:0050794	0.507	regulation of cellular process
GO:0055088	0.461	lipid homeostasis
GO:0042632	0.405	cholesterol homeostasis
GO:0042157	0.325	lipoprotein metabolic process
GO:0042221	0.311	response to chemical
GO:0044085	0.301	cellular component biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0005829	0.936	cytosol
GO:0016020	0.867	membrane
GO:0005794	0.667	Golgi apparatus
GO:0031974	0.549	membrane-enclosed lumen
GO:0043233	0.539	organelle lumen
GO:0070013	0.523	intracellular organelle lumen
GO:0032991	0.448	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:39747	1.000	cholesterol(in) = cholesterol(out)

[back to server]