StarFunc result for job id P55160

User Input

>input (1127 residues)
MSLTSAYQHKLAEKLTILNDRGQGVLIRMYNIKKTCSDPKSKPPFLLEKSMEPSLKYINK
KFPNIDVRNSTQHLGPVHREKAEIIRFLTNYYQSFVDVMEFRDHVYELLNTIDACQCHFD
INLNFDFTRSYLDLIVTYTSVILLLSRIEDRRILIGMYNCAHEMLHGHGDPSFARLGQMV
LEYDHPLKKLTEEFGPHTKAVSGALLSLHFLFVRRNQGAEQWRSAQLLSLISNPPAMINP
ANSDTMACEYLSVEVMERWIIIGFLLCHGCLNSNSQCQKLWKLCLQGSLYITLIREDVLQ
VHKVTEDLFSSLKGYGKRVADIKESKEHVIANSGQFHCQRRQFLRMAVKELETVLADEPG
LLGPKALFAFMALSFIRDEVTWLVRHTENVTKTKTPEDYADSSIAELLFLLEGIRSLVRR
HIKVIQQYHLQYLARFDALVLSDIIQNLSVCPEEESIIMSSFVSILSSLNLKQVDNGEKF
EFSGLRLDWFRLQAYTSVAKAPLHLHENPDLAKVMNLIVFHSRMLDSVEKLLVETSDLST
FCFHLRIFEKMFAMTLEESAMLRYAIAFPLICAHFVHCTHEMCPEEYPHLKNHGLHHCNS
FLEELAKQTSNCVLEICAEQRNLSEQLLPKHCATTISKAKNKKTRKQRQTPRKGEPERDK
PGAESHRKNRSIVTNMDKLHLNLTELALTMNHVYSFSVFEHTIFPSEYLSSHLEARLNRA
IVWLAGYNATTQEIVRPSELLAGVKAYIGFIQSLAQFLGADASRVIRNALLQQTQPLDSC
GEQTITTLYTNWYLESLLRQASSGTIILSPAMQAFVSLPREGEQNFSAEEFSDISEMRAL
AELLGPYGMKFLSENLMWHVTSQIVELKKLVVENMDILVQIRSNFSKPDLMASLLPQLTG
AENVLKRMTIIGVILSFRAMAQEGLREVFSSHCPFLMGPIECLKEFVTPDTDIKVTLSIF
ELASAAGVGCDIDPALVAAIANLKADTSSPEEEYKVACLLLIFLAVSLPLLATDPSSFYS
IEKDGYNNNIHCLTKAIIQVSAALFTLYNKNIETHLKEFLVVASVSLLQLGQETDKLKTR
NRESISLLMRLVVEESSFLTLDMLESCFPYVLLRNAYREVSRAFHLN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8K1X4	0.995	0.988	0.000	1134	0.948	0.942	Q8K1X4.pdb.gz	NCKPL_MOUSE Nck-associated protein 1-like OS=Mus musculus OX=10090 GN=Nckap1l PE=1 SV=1
2	AFDB:B0S6R1	0.947	0.946	1.327E-92	1128	0.587	0.587	B0S6R1.pdb.gz	NCKP1_DANRE Nck-associated protein 1 OS=Danio rerio OX=7955 GN=nckap1 PE=3 SV=1
3	PDB:7useB	0.935	0.958	5.383E-86	1099	0.578	0.592	7useB.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
4	AFDB:P55162	0.940	0.941	2.845E-81	1126	0.475	0.475	P55162.pdb.gz	HEM_DROME Membrane-associated protein Hem OS=Drosophila melanogaster OX=7227 GN=Hem PE=2 SV=1
5	AFDB:P55163	0.909	0.899	9.755E-69	1141	0.362	0.358	P55163.pdb.gz	GEX3_CAEEL Membrane-associated protein gex-3 OS=Caenorhabditis elegans OX=6239 GN=gex-3 PE=1 SV=2
6	AFDB:Q869Q3	0.807	0.787	4.415E-45	1160	0.235	0.228	Q869Q3.pdb.gz	NAPA_DICDI Nck-associated protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=napA PE=1 SV=1
7	AFDB:Q5S2C4	0.785	0.636	1.481E-35	1425	0.205	0.162	Q5S2C4.pdb.gz	NCKP1_ARATH Protein NAP1 OS=Arabidopsis thaliana OX=3702 GN=NAP1 PE=1 SV=2
8	AFDB:Q7ZVM1	0.362	0.354	1.987E-14	1159	0.119	0.116	Q7ZVM1.pdb.gz	WASC5_DANRE WASH complex subunit 5 OS=Danio rerio OX=7955 GN=washc5 PE=2 SV=1
9	AFDB:Q54IR8	0.353	0.344	2.532E-14	1164	0.125	0.121	Q54IR8.pdb.gz	WASC5_DICDI WASH complex subunit 5 OS=Dictyostelium discoideum OX=44689 GN=washc5 PE=1 SV=1
10	AFDB:Q12768	0.374	0.366	1.290E-13	1159	0.114	0.111	Q12768.pdb.gz	WASC5_HUMAN WASH complex subunit 5 OS=Homo sapiens OX=9606 GN=WASHC5 PE=1 SV=1
11	PDB:7usdA	0.397	0.381	3.868E-12	1185	0.133	0.127	7usdA.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
12	AFDB:Q9VF87	0.420	0.379	1.962E-11	1291	0.130	0.113	Q9VF87.pdb.gz	CYFIP_DROME Cytoplasmic FMR1-interacting protein OS=Drosophila melanogaster OX=7227 GN=Cyfip PE=1 SV=1
13	PDB:6tc0C	0.105	0.115	7.062E-4	994	0.126	0.143	6tc0C.pdb.gz
14	PDB:7wttK	0.102	0.108	9.318E-4	1022	0.107	0.118	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
15	PDB:3gjxA	0.095	0.099	1.070E-3	1041	0.122	0.133	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
16	PDB:7mp6B	0.133	0.110	1.364E-3	1609	0.124	0.087	7mp6B.pdb.gz
17	PDB:7unkA	0.090	0.096	1.567E-3	1047	0.122	0.132	7unkA.pdb.gz
18	PDB:6vaeA	0.089	0.085	1.929E-3	1198	0.115	0.109	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
19	PDB:7kzvV	0.074	0.073	1.929E-3	1155	0.122	0.119	7kzvV.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
20	PDB:6bcuA	0.074	0.048	2.067E-3	2204	0.131	0.067	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0S6R1	0.0	1409	1128	0.587	0.587	NCKP1_DANRE Nck-associated protein 1 OS=Danio rerio OX=7955 GN=nckap1 PE=3 SV=1
2	P28660	0.0	1410	1128	0.587	0.586	NCKP1_MOUSE Nck-associated protein 1 OS=Mus musculus OX=10090 GN=Nckap1 PE=1 SV=2
3	P55160	0.0	2334	1127	1.000	1.000	NCKPL_HUMAN Nck-associated protein 1-like OS=Homo sapiens OX=9606 GN=NCKAP1L PE=1 SV=3
4	P55161	0.0	1410	1128	0.587	0.586	NCKP1_RAT Nck-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Nckap1 PE=2 SV=1
5	P55162	0.0	1092	1126	0.475	0.475	HEM_DROME Membrane-associated protein Hem OS=Drosophila melanogaster OX=7227 GN=Hem PE=2 SV=1
6	P55163	0.0	735	1141	0.367	0.363	GEX3_CAEEL Membrane-associated protein gex-3 OS=Caenorhabditis elegans OX=6239 GN=gex-3 PE=1 SV=2
7	Q640K3	0.0	1404	1128	0.585	0.584	NCKP1_XENLA Nck-associated protein 1 OS=Xenopus laevis OX=8355 GN=nckap1 PE=2 SV=1
8	Q8K1X4	0.0	2229	1134	0.949	0.943	NCKPL_MOUSE Nck-associated protein 1-like OS=Mus musculus OX=10090 GN=Nckap1l PE=1 SV=1
9	Q9Y2A7	0.0	1412	1128	0.587	0.587	NCKP1_HUMAN Nck-associated protein 1 OS=Homo sapiens OX=9606 GN=NCKAP1 PE=1 SV=1
10	Q869Q3	2.62e-89	314	1160	0.246	0.239	NAPA_DICDI Nck-associated protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=napA PE=1 SV=1
11	Q5S2C4	3.71e-36	151	1425	0.203	0.161	NCKP1_ARATH Protein NAP1 OS=Arabidopsis thaliana OX=3702 GN=NAP1 PE=1 SV=2
12	Q50L36	0.66	36.6	595	0.028	0.052	ISPS_POPAL Isoprene synthase, chloroplastic OS=Populus alba OX=43335 GN=ISPS PE=1 SV=1
13	P35908	0.85	36.2	639	0.036	0.064	K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens OX=9606 GN=KRT2 PE=1 SV=2
14	B9DFU2	1.1	35.8	522	0.028	0.059	MAX1_ARATH Cytochrome P450 711A1 OS=Arabidopsis thaliana OX=3702 GN=CYP711A1 PE=2 SV=1
15	P25560	1.8	33.9	188	0.022	0.133	RER1_YEAST Protein RER1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RER1 PE=1 SV=2
16	Q3TTY5	2.4	34.7	707	0.025	0.040	K22E_MOUSE Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1
17	Q6FR56	3.0	32.7	143	0.019	0.147	RS16_CANGA Small ribosomal subunit protein uS9 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=RPS16 PE=3 SV=1
18	Q5SML5	4.0	33.9	696	0.028	0.046	ORR22_ORYSJ Two-component response regulator ORR22 OS=Oryza sativa subsp. japonica OX=39947 GN=RR22 PE=2 SV=1
19	P14131	4.2	32.3	146	0.015	0.116	RS16_MOUSE Small ribosomal subunit protein uS9 OS=Mus musculus OX=10090 GN=Rps16 PE=1 SV=4
20	P62249	4.2	32.3	146	0.015	0.116	RS16_HUMAN Small ribosomal subunit protein uS9 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09735 Nckap1	0	1594.6	Nck-associated protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000293373

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000432472	0.996	Protein BRICK1
2	9606.ENSP00000444645	0.996	Cytoplasmic FMR1-interacting protein 2
3	9606.ENSP00000481038	0.996	Cytoplasmic FMR1-interacting protein 1
4	9606.ENSP00000365312	0.995	Abl interactor 1
5	9606.ENSP00000483313	0.993	Wiskott-Aldrich syndrome protein family member 2
6	9606.ENSP00000295851	0.978	Abl interactor 2
7	9606.ENSP00000376368	0.977	Wiskott-Aldrich syndrome protein family member 1
8	9606.ENSP00000335055	0.963	Wiskott-Aldrich syndrome protein family member 3
9	9606.ENSP00000361423	0.949	Tyrosine-protein kinase ABL1
10	9606.ENSP00000365891	0.921	Wiskott-Aldrich syndrome protein
11	9606.ENSP00000215832	0.902	Mitogen-activated protein kinase 1
12	9606.ENSP00000263025	0.902	Mitogen-activated protein kinase 3
13	9606.ENSP00000354251	0.902	Nck-associated protein 1
14	9606.ENSP00000337513	0.900	Steroid receptor RNA activator 1
15	9606.ENSP00000440005	0.881	ADP-ribosylation factor 1
16	9606.ENSP00000249071	0.872	Ras-related C3 botulinum toxin substrate 2
17	9606.ENSP00000367220	0.869	Actin-related protein 2
18	9606.ENSP00000223023	0.833	Neural Wiskott-Aldrich syndrome protein
19	9606.ENSP00000417273	0.811	Cytoplasmic protein NCK1
20	9606.ENSP00000376330	0.794	WAS/WASL-interacting protein family member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0002682	0.995	regulation of immune system process
GO:0002376	0.994	immune system process
GO:0042129	0.992	regulation of T cell proliferation
GO:0050870	0.990	positive regulation of T cell activation
GO:0030334	0.975	regulation of cell migration
GO:0048583	0.974	regulation of response to stimulus
GO:0070665	0.967	positive regulation of leukocyte proliferation
GO:0032946	0.963	positive regulation of mononuclear cell proliferation
GO:0019222	0.956	regulation of metabolic process
GO:0050896	0.954	response to stimulus
GO:1902905	0.954	positive regulation of supramolecular fiber organization
GO:0060255	0.953	regulation of macromolecule metabolic process
GO:0051495	0.951	positive regulation of cytoskeleton organization
GO:0050671	0.951	positive regulation of lymphocyte proliferation
GO:0060627	0.950	regulation of vesicle-mediated transport
GO:0110053	0.949	regulation of actin filament organization
GO:0030029	0.948	actin filament-based process
GO:0048519	0.944	negative regulation of biological process
GO:0042102	0.944	positive regulation of T cell proliferation
GO:0032501	0.943	multicellular organismal process
GO:0043254	0.943	regulation of protein-containing complex assembly
GO:0044089	0.939	positive regulation of cellular component biogenesis
GO:0008064	0.937	regulation of actin polymerization or depolymerization
GO:0007010	0.935	cytoskeleton organization
GO:0030036	0.933	actin cytoskeleton organization
GO:0007165	0.917	signal transduction
GO:0032273	0.917	positive regulation of protein polymerization
GO:0048584	0.915	positive regulation of response to stimulus
GO:0030833	0.908	regulation of actin filament polymerization
GO:0030838	0.900	positive regulation of actin filament polymerization
GO:0050776	0.888	regulation of immune response
GO:0051174	0.881	regulation of phosphorus metabolic process
GO:0048856	0.867	anatomical structure development
GO:0007166	0.839	cell surface receptor signaling pathway
GO:0030865	0.833	cortical cytoskeleton organization
GO:0080090	0.804	regulation of primary metabolic process
GO:0002685	0.802	regulation of leukocyte migration
GO:0040017	0.799	positive regulation of locomotion
GO:0048870	0.772	cell motility
GO:0051171	0.764	regulation of nitrogen compound metabolic process
GO:0030335	0.760	positive regulation of cell migration
GO:0051246	0.754	regulation of protein metabolic process
GO:0009892	0.750	negative regulation of metabolic process
GO:0048523	0.739	negative regulation of cellular process
GO:0002683	0.733	negative regulation of immune system process
GO:0002687	0.711	positive regulation of leukocyte migration
GO:0019220	0.709	regulation of phosphate metabolic process
GO:0050864	0.702	regulation of B cell activation
GO:0048869	0.700	cellular developmental process
GO:0042221	0.694	response to chemical
GO:0050871	0.667	positive regulation of B cell activation
GO:0010468	0.662	regulation of gene expression
GO:0070887	0.659	cellular response to chemical stimulus
GO:0016477	0.644	cell migration
GO:0051241	0.621	negative regulation of multicellular organismal process
GO:0030866	0.621	cortical actin cytoskeleton organization
GO:1902624	0.621	positive regulation of neutrophil migration
GO:0010605	0.618	negative regulation of macromolecule metabolic process
GO:0009605	0.572	response to external stimulus
GO:0048872	0.570	homeostasis of number of cells
GO:0002262	0.535	myeloid cell homeostasis
GO:0030100	0.515	regulation of endocytosis
GO:0030154	0.514	cell differentiation
GO:0009893	0.483	positive regulation of metabolic process
GO:0032101	0.453	regulation of response to external stimulus
GO:0034101	0.452	erythrocyte homeostasis
GO:0048468	0.449	cell development
GO:0050793	0.432	regulation of developmental process
GO:0001817	0.399	regulation of cytokine production
GO:0051050	0.398	positive regulation of transport
GO:0010629	0.369	negative regulation of gene expression
GO:0060284	0.334	regulation of cell development
GO:0045597	0.334	positive regulation of cell differentiation
GO:0065009	0.326	regulation of molecular function
GO:0010604	0.300	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031209	0.999	SCAR complex
GO:0031982	0.926	vesicle
GO:0043229	0.884	intracellular organelle
GO:0016020	0.876	membrane
GO:0005829	0.829	cytosol
GO:0043231	0.814	intracellular membrane-bounded organelle
GO:0012505	0.558	endomembrane system
GO:0030054	0.359	cell junction
GO:0071944	0.347	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]