StarFunc result for job id P55196

User Input

>input (1824 residues)
MSAGGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCI
RVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKD
DREGRFVLKNENDAIPPKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKREKEALRQA
SDKDDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSS
DGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARV
MLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPDHIPKKTKKHLE
GKTPKGKERADGSGYGSTLPPEKLPYLVELSPGRRNHFAYYNYHTYEDGSDSRDKPKLYR
LQLSVTEVGTEKLDDNSIQLFGPGIQPHHCDLTNMDGVVTVTPRSMDAETYVEGQRISET
TMLQSGMKVQFGASHVFKFVDPSQDHALAKRSVDGGLMVKGPRHKPGIVQETTFDLGGDI
HSGTALPTSKSTTRLDSDRVSSASSTAERGMVKPMIRVEQQPDYRRQESRTQDASGPELI
LPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSNQYRPDISPTERT
HKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLA
HLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSLQRPKIDDVLHTLTGAMSLLRRCRVNA
ALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHYWGAIIRQQLGHIEAWAEKQGLELAAD
CHLSRIVQATTLLTMDKYAPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIE
NVVTVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRNIPNGLQEFLDPLC
QRGFCRLIPHTRSPGTWTIYFEGADYESHLLRENTELAQPLRKEPEIITVTLKKQNGMGL
SIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTR
TSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRISDRRGSGKPRPKSEGFELYNNSTQNGS
PESPQLPWAEYSEPKKLPGDDRLMKNRADHRSSPNVANQPPSPGGKSAYASGTTAKITSV
STGNLCTEEQTPPPRPEAYPIPTQTYTREYFTFPASKSQDRMAPPQNQWPNYEEKPHMHT
DSNHSSIAIQRVTRSQEELREDKAYQLERHRIEAAMDRKSDSDMWINQSSSLDSSTSSQE
HLNHSSKSVTPASTLTKSGPGRWKTPAAIPATPVAVSQPIRTDLPPPPPPPPVHYAGDFD
GMSMDLPLPPPPSANQIGLPSAQVAAAERRKREEHQRWYEKEKARLEEERERKRREQERK
LGQMRTQSLNPAPFSPLTAQQMKPEKPSTLQRPQETVIRELQPQQQPRTIERRDLQYITV
SKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAEESDRLRKL
MLEWQFQKRLQESKQKDEDDEEEEDDDVDTMLIMQRLEAERRARLQDEERRRQQQLEEMR
KREAEDRARQEEERRRQEEERTKRDAEEKRRQEEGYYSRLEAERRRQHDEAARRLLEPEA
PGLCRPPLPRDYEPPSPSPAPGAPPPPPQRNASYLKTQVLSPDSLFTAKFVAYNEEEEEE
DCSLAGPNSYPGSTGAAVGAHDACRDAKEKRSKSQDADSPGSSGAPENLTFKERQRLFSQ
GQDVSNKVKASRKLTELENELNTK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35889	0.372	0.371	0.000	1829	0.931	0.929	O35889.pdb.gz	AFAD_RAT Afadin OS=Rattus norvegicus OX=10116 GN=Afdn PE=1 SV=1
2	AFDB:Q9VN82	0.299	0.272	0.000	2051	0.353	0.314	Q9VN82.pdb.gz	Q9VN82_DROME Canoe, isoform E OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=2
3	AFDB:G5ECK4	0.051	0.057	9.899E-8	1523	0.098	0.118	G5ECK4.pdb.gz	G5ECK4_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnbp-1 PE=1 SV=1
4	AFDB:Q60592	0.059	0.061	3.491E-7	1734	0.120	0.126	Q60592.pdb.gz	MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Mast2 PE=1 SV=1
5	PDB:7wrgA	0.055	0.120	1.822E-6	812	0.016	0.036	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
6	AFDB:Q15700	0.047	0.097	1.999E-6	870	0.036	0.076	Q15700.pdb.gz	DLG2_HUMAN Disks large homolog 2 OS=Homo sapiens OX=9606 GN=DLG2 PE=1 SV=3
7	AFDB:Q9VAS9	0.059	0.048	2.673E-6	2417	0.120	0.090	Q9VAS9.pdb.gz	Q9VAS9_DROME APC-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Apc PE=3 SV=1
8	AFDB:Q6P0Q8	0.051	0.052	3.246E-6	1798	0.113	0.115	Q6P0Q8.pdb.gz	MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2 PE=1 SV=2
9	AFDB:A0A087X1S9	0.049	0.083	3.940E-6	1069	0.064	0.109	A0A087X1S9.pdb.gz	A0A087X1S9_HUMAN Par-3 family cell polarity regulator beta (Fragment) OS=Homo sapiens OX=9606 GN=PARD3B PE=1 SV=1
10	AFDB:Q9ES67	0.046	0.052	3.940E-6	1527	0.087	0.104	Q9ES67.pdb.gz	ARHGB_RAT Rho guanine nucleotide exchange factor 11 OS=Rattus norvegicus OX=10116 GN=Arhgef11 PE=1 SV=1
11	AFDB:O15085	0.046	0.053	8.982E-6	1522	0.083	0.099	O15085.pdb.gz	ARHGB_HUMAN Rho guanine nucleotide exchange factor 11 OS=Homo sapiens OX=9606 GN=ARHGEF11 PE=1 SV=1
12	PDB:7pc3A	0.048	0.202	2.620E-5	405	0.019	0.084	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	PDB:7wrgB	0.054	0.123	3.339E-5	783	0.015	0.034	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
14	PDB:2xkxA	0.044	0.107	1.912E-4	721	0.018	0.044	2xkxA.pdb.gz
15	PDB:7p73A	0.043	0.182	2.007E-4	420	0.016	0.071	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
16	PDB:2kb3A	0.048	0.508	5.829E-4	143	0.012	0.147	2kb3A.pdb.gz
17	PDB:7dvqX	0.052	0.521	6.118E-4	156	0.013	0.154	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
18	PDB:7p70A	0.043	0.184	6.118E-4	407	0.016	0.074	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
19	PDB:5n7dA	0.046	0.187	7.076E-4	423	0.013	0.054	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
20	PDB:7lq1A	0.051	0.075	7.796E-4	950	0.052	0.100	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KGI6	0.0	906	1951	0.288	0.270	A0A0B4KGI6_DROME Canoe, isoform G OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1
2	A8MQ02	0.0	3677	1781	0.976	0.999	A8MQ02_HUMAN Afadin, adherens junction formation factor OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=2
3	H0Y7R8	0.0	776	389	0.207	0.969	H0Y7R8_HUMAN Afadin, adherens junction formation factor (Fragment) OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=1
4	J3KN01	0.0	3726	1816	0.992	0.996	J3KN01_HUMAN Afadin, adherens junction formation factor OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=2
5	O35889	0.0	3333	1829	0.931	0.928	AFAD_RAT Afadin OS=Rattus norvegicus OX=10116 GN=Afdn PE=1 SV=1
6	P55196	0.0	3780	1824	1.000	1.000	AFAD_HUMAN Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3
7	Q5TIG5	0.0	3415	1665	0.904	0.990	Q5TIG5_HUMAN Afadin, adherens junction formation factor OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=1
8	Q9QZQ1	0.0	3354	1820	0.930	0.932	AFAD_MOUSE Afadin OS=Mus musculus OX=10090 GN=Afdn PE=1 SV=3
9	E9PFY5	2.49e-166	507	250	0.137	0.996	E9PFY5_HUMAN Afadin, adherens junction formation factor (Fragment) OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=1
10	F8W9I4	2.70e-165	504	247	0.135	0.996	F8W9I4_HUMAN Afadin, adherens junction formation factor (Fragment) OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=1
11	A0A0B4KFK9	1.28e-159	535	1721	0.153	0.162	A0A0B4KFK9_DROME Canoe, isoform F OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1
12	Q8IPP3	1.00e-158	535	1817	0.149	0.149	Q8IPP3_DROME Canoe, isoform D OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=2
13	A0A0B4KF82	2.33e-158	534	1818	0.148	0.149	A0A0B4KF82_DROME Canoe, isoform I OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1
14	Q9VN82	1.52e-157	535	2051	0.153	0.136	Q9VN82_DROME Canoe, isoform E OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=2
15	Q95TT5	1.66e-157	535	2051	0.153	0.136	Q95TT5_DROME LD24616p OS=Drosophila melanogaster OX=7227 GN=cno PE=2 SV=1
16	A0A0B4KG43	2.10e-157	533	1968	0.148	0.137	A0A0B4KG43_DROME Canoe, isoform H OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1
17	Q9BIC1	9.43e-153	515	1658	0.213	0.234	Q9BIC1_CAEEL Afadin OS=Caenorhabditis elegans OX=6239 GN=afd-1 PE=1 SV=1
18	Q8IPP4	1.90e-143	492	1882	0.143	0.138	Q8IPP4_DROME Canoe, isoform C OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1
19	Q24279	5.48e-143	491	1893	0.142	0.137	Q24279_DROME Cno OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1
20	H0YA98	1.82e-109	347	167	0.089	0.976	H0YA98_HUMAN Afadin, adherens junction formation factor (Fragment) OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01843 DIL	1.1e-27	107.7	DIL domain
2	PF00498 FHA	0.0022	29.6	FHA domain
3	PF00595 PDZ	1.9e-13	61.8	PDZ domain
4	PF13180 PDZ_2	1.4	20.6	PDZ domain
5	PF17820 PDZ_6	0.001	30.2	PDZ domain
6	PF00788 RA	7e-44	159.7	Ras association (RalGDS/AF-6) domain
7	PF16697 Yop-YscD_cpl	23	16.7	Inner membrane component of T3SS, cytoplasmic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000008230

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000007252	0.992	HRas proto-oncogene, GTPase
2	60711.ENSCSAP00000014795	0.990	Nectin cell adhesion molecule 2
3	60711.ENSCSAP00000002759	0.988	Nectin cell adhesion molecule 3
4	60711.ENSCSAP00000015558	0.987	Nectin cell adhesion molecule 1
5	60711.ENSCSAP00000004025	0.984	KRAS proto-oncogene, GTPase
6	60711.ENSCSAP00000015427	0.982	F11 receptor
7	60711.ENSCSAP00000002310	0.979	Catenin delta 1
8	60711.ENSCSAP00000015414	0.973	Nectin cell adhesion molecule 4
9	60711.ENSCSAP00000016600	0.973	Synovial sarcoma, X breakpoint 2 interacting protein
10	60711.ENSCSAP00000003039	0.972	Tight junction protein 1
11	60711.ENSCSAP00000009270	0.971	Catenin alpha 1
12	60711.ENSCSAP00000016369	0.969	NRAS proto-oncogene, GTPase
13	60711.ENSCSAP00000016446	0.969	RAP1A, member of RAS oncogene family
14	60711.ENSCSAP00000000647	0.962	annotation not available
15	60711.ENSCSAP00000004708	0.961	Tight junction protein 2
16	60711.ENSCSAP00000004235	0.960	Signal-induced proliferation-associated 1
17	60711.ENSCSAP00000011958	0.955	annotation not available
18	60711.ENSCSAP00000001033	0.953	Related RAS viral (r-ras) oncogene homolog 2
19	60711.ENSCSAP00000007225	0.924	Muscle RAS oncogene homolog
20	60711.ENSCSAP00000000450	0.900	Cadherins are calcium-dependent cell adhesion proteins.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050839	0.999	cell adhesion molecule binding
GO:0019904	0.997	protein domain specific binding
GO:0019899	0.686	enzyme binding
GO:0030274	0.546	LIM domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0009987	0.997	cellular process
GO:0032501	0.989	multicellular organismal process
GO:0050794	0.986	regulation of cellular process
GO:0007275	0.979	multicellular organism development
GO:0048731	0.972	system development
GO:0016043	0.968	cellular component organization
GO:0045216	0.962	cell-cell junction organization
GO:0007399	0.953	nervous system development
GO:0030154	0.950	cell differentiation
GO:0044085	0.949	cellular component biogenesis
GO:0009888	0.947	tissue development
GO:0048518	0.935	positive regulation of biological process
GO:0048522	0.934	positive regulation of cellular process
GO:0046931	0.906	pore complex assembly
GO:0048468	0.905	cell development
GO:0060429	0.890	epithelium development
GO:0050896	0.836	response to stimulus
GO:0009653	0.809	anatomical structure morphogenesis
GO:0030855	0.797	epithelial cell differentiation
GO:0051239	0.762	regulation of multicellular organismal process
GO:0048583	0.762	regulation of response to stimulus
GO:0065008	0.749	regulation of biological quality
GO:0050793	0.747	regulation of developmental process
GO:0010646	0.747	regulation of cell communication
GO:0023051	0.746	regulation of signaling
GO:0022603	0.726	regulation of anatomical structure morphogenesis
GO:0051128	0.693	regulation of cellular component organization
GO:0007155	0.681	cell adhesion
GO:0022604	0.619	regulation of cell morphogenesis
GO:0023052	0.617	signaling
GO:0007154	0.617	cell communication
GO:0051716	0.578	cellular response to stimulus
GO:0009966	0.571	regulation of signal transduction
GO:0007165	0.570	signal transduction
GO:0022008	0.569	neurogenesis
GO:0051094	0.547	positive regulation of developmental process
GO:2000026	0.539	regulation of multicellular organismal development
GO:0048519	0.522	negative regulation of biological process
GO:0051179	0.511	localization
GO:0044057	0.479	regulation of system process
GO:0042391	0.439	regulation of membrane potential
GO:0048523	0.406	negative regulation of cellular process
GO:0031644	0.386	regulation of nervous system process
GO:0048584	0.378	positive regulation of response to stimulus
GO:0034329	0.369	cell junction assembly
GO:0045595	0.359	regulation of cell differentiation
GO:0030030	0.356	cell projection organization
GO:0023056	0.353	positive regulation of signaling
GO:0010647	0.353	positive regulation of cell communication
GO:0098609	0.323	cell-cell adhesion
GO:0099177	0.323	regulation of trans-synaptic signaling
GO:0048513	0.322	animal organ development
GO:0019222	0.321	regulation of metabolic process
GO:0051240	0.319	positive regulation of multicellular organismal process
GO:0032879	0.306	regulation of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	1.000	cell junction
GO:0005886	0.999	plasma membrane
GO:0005634	0.998	nucleus
GO:0005829	0.997	cytosol
GO:0005911	0.949	cell-cell junction
GO:0070013	0.944	intracellular organelle lumen
GO:0031981	0.925	nuclear lumen
GO:0005654	0.914	nucleoplasm
GO:0032991	0.894	protein-containing complex
GO:0016604	0.851	nuclear body
GO:0016607	0.807	nuclear speck
GO:0005912	0.661	adherens junction
GO:0043232	0.563	intracellular non-membrane-bounded organelle
GO:0120025	0.492	plasma membrane bounded cell projection
GO:0043005	0.361	neuron projection
GO:0045202	0.358	synapse
GO:0036477	0.353	somatodendritic compartment
GO:0012505	0.327	endomembrane system
GO:0030424	0.310	axon

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]