StarFunc result for job id P55197

User Input

>input (1068 residues)
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQ
VPTGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVSTM
EPIVLQSVPHDRYNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEE
EGNGADNVQYCGYCKYHFSKLKKSKRGSNRSYDQSLSDSSSHSQDKHHEKEKKKYKEKDK
HKQKHKKQPEPSPALVPSLTVTTEKTYTSTSNNSISGSLKRLEDTTARFTNANFQEVSAH
TSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQGSFSGTPGSV
KSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGL
PSTSAVTSQPKSFENSPGDLGNSSLPTAGYKRAQTSGIEEETVKEKKRKGNKQSKHGPGR
PKGNKNQENVSHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGS
EISMQYRHDGACPTTTFSELLNAIHNGIYNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQS
SGHLQQVGALSPSAVSSAAPAVATTQANTLSGSSLSQAPSHMYGNRSNSSMAALIAQSEN
NQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRYDQPGNSSLENLPPVAASIEQLL
ERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSV
PFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQS
TSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIG
ALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLL
SDQQRQILIHQQQFQQLLNSQQLTPEQHQAFLYQLMQHHHQQHHQPELQQLQIPGPTQIP
INNLLAGTQAPPLHTATTNPFLTIHGDNASQKVARLSDKTGPVAQEKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O54826	0.484	0.484	0.000	1068	0.932	0.932	O54826.pdb.gz	AF10_MOUSE Protein AF-10 OS=Mus musculus OX=10090 GN=Mllt10 PE=1 SV=2
2	AFDB:F8W451	0.251	0.238	1.389E-79	1133	0.528	0.498	F8W451.pdb.gz	F8W451_DANRE MLLT10 histone lysine methyltransferase DOT1L cofactor OS=Danio rerio OX=7955 GN=mllt10 PE=4 SV=1
3	AFDB:F8W2W1	0.193	0.191	3.789E-78	1078	0.502	0.497	F8W2W1.pdb.gz
4	AFDB:A0A2R8RZV0	0.205	0.206	6.886E-69	1059	0.478	0.482	A0A2R8RZV0.pdb.gz
5	AFDB:B1AR10	0.219	0.212	1.627E-66	1109	0.424	0.408	B1AR10.pdb.gz	B1AR10_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
6	AFDB:B1AR09	0.195	0.193	5.434E-65	1079	0.404	0.399	B1AR09.pdb.gz	B1AR09_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
7	AFDB:A0A0B4KGP1	0.173	0.110	5.594E-37	1717	0.269	0.167	A0A0B4KGP1.pdb.gz	A0A0B4KGP1_DROME Alhambra, isoform P OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
8	AFDB:Q7KMH9	0.045	0.038	1.272E-6	1420	0.146	0.110	Q7KMH9.pdb.gz	Q7KMH9_DROME BcDNA.LD26050 OS=Drosophila melanogaster OX=7227 GN=wde PE=1 SV=1
9	AFDB:Q07436	0.047	0.038	3.469E-5	1427	0.159	0.119	Q07436.pdb.gz	EXPA_DROME Protein expanded OS=Drosophila melanogaster OX=7227 GN=ex PE=1 SV=3
10	AFDB:M9PB92	0.033	0.033	3.680E-4	1062	0.099	0.100	M9PB92.pdb.gz	M9PB92_DROME CCR4-NOT transcription complex subunit 4, isoform K OS=Drosophila melanogaster OX=7227 GN=Cnot4 PE=1 SV=1
11	PDB:7ajuCK	0.028	0.093	3.388	222	0.015	0.072	7ajuCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
12	PDB:6ydhA	0.035	0.314	3.624	62	0.009	0.161	6ydhA.pdb.gz
13	PDB:2lgvA	0.037	0.232	5.079	100	0.008	0.090	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
14	PDB:7uy5I	0.023	0.041	5.812	528	0.007	0.015	7uy5I.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
15	PDB:7oqyY	0.023	0.107	6.218	92	0.011	0.130	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
16	PDB:2wu9A	0.029	0.060	7.613	403	0.005	0.012	2wu9A.pdb.gz
17	PDB:1cgiE	0.028	0.085	8.144	245	0.004	0.016	1cgiE.pdb.gz
18	PDB:4r8pL	0.031	0.099	8.713	254	0.005	0.020	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
19	PDB:5znxA	0.028	0.206	9.321	95	0.007	0.074	5znxA.pdb.gz
20	PDB:5datn4	0.033	0.227	9.971	135	0.007	0.059	5datn4.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8W451	0.0	761	1133	0.557	0.525	F8W451_DANRE MLLT10 histone lysine methyltransferase DOT1L cofactor OS=Danio rerio OX=7955 GN=mllt10 PE=4 SV=1
2	O54826	0.0	1781	1068	0.932	0.932	AF10_MOUSE Protein AF-10 OS=Mus musculus OX=10090 GN=Mllt10 PE=1 SV=2
3	P55197	0.0	2182	1068	1.000	1.000	AF10_HUMAN Protein AF-10 OS=Homo sapiens OX=9606 GN=MLLT10 PE=1 SV=2
4	Q5JT35	0.0	1098	763	0.583	0.817	Q5JT35_HUMAN MLLT10 histone lysine methyltransferase DOT1L cofactor (Fragment) OS=Homo sapiens OX=9606 GN=MLLT10 PE=1 SV=2
5	B1AR10	3.83e-167	523	1109	0.348	0.335	B1AR10_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
6	B1AR09	5.50e-167	522	1079	0.346	0.342	B1AR09_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
7	Q8VHB4	1.00e-165	518	1079	0.344	0.340	Q8VHB4_MOUSE MLLT6 OS=Mus musculus OX=10090 GN=Mllt6 PE=2 SV=1
8	Q6P2C6	6.50e-135	412	325	0.191	0.628	Q6P2C6_HUMAN MLLT6 protein OS=Homo sapiens OX=9606 GN=MLLT6 PE=1 SV=1
9	P55198	2.91e-133	433	1093	0.185	0.181	AF17_HUMAN Protein AF-17 OS=Homo sapiens OX=9606 GN=MLLT6 PE=1 SV=3
10	Q9VI63	1.37e-103	357	1376	0.132	0.102	Q9VI63_DROME AF10 OS=Drosophila melanogaster OX=7227 GN=Alh PE=2 SV=3
11	Q7KSZ0	1.47e-103	356	1323	0.132	0.107	Q7KSZ0_DROME Alhambra OS=Drosophila melanogaster OX=7227 GN=Alh PE=2 SV=1
12	A0A0B4KFD2	1.89e-103	356	1332	0.132	0.106	A0A0B4KFD2_DROME Alhambra, isoform L OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
13	A0A0B4KGB4	1.98e-103	357	1385	0.132	0.102	A0A0B4KGB4_DROME Alhambra, isoform K OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
14	Q7YU77	2.26e-103	356	1374	0.132	0.103	Q7YU77_DROME SD04152p OS=Drosophila melanogaster OX=7227 GN=Alh PE=2 SV=1
15	A0A0B4KGP1	2.59e-103	359	1717	0.132	0.082	A0A0B4KGP1_DROME Alhambra, isoform P OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
16	Q962D1	2.15e-101	350	1321	0.131	0.106	Q962D1_DROME Zinc finger/leucine zipper protein DALF isoform C3 OS=Drosophila melanogaster OX=7227 GN=Alh PE=2 SV=1
17	P34447	1.67e-77	275	867	0.106	0.130	ZFP1_CAEEL Zinc finger protein zfp-1 OS=Caenorhabditis elegans OX=6239 GN=zfp-1 PE=1 SV=2
18	Q3UPK1	1.46e-58	220	946	0.229	0.259	Q3UPK1_MOUSE PHD-type domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Mllt6 PE=2 SV=1
19	P55201	4.37e-44	176	1214	0.081	0.071	BRPF1_HUMAN Peregrin OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
20	B2RRD7	6.11e-44	176	1212	0.081	0.071	BRPF1_MOUSE Peregrin OS=Mus musculus OX=10090 GN=Brpf1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00628 PHD	8.6e-05	33.7	PHD-finger
2	PF13831 PHD_2	8.7e-10	49.2	PHD-finger
3	PF13771 zf-HC5HC2H	1.6e-15	68.4	PHD-like zinc-binding domain
4	PF13832 zf-HC5HC2H_2	5.2e-28	108.8	PHD-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307411

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381657	0.999	Histone-lysine N-methyltransferase, H3 lysine-79 specific
2	9606.ENSP00000369695	0.985	Protein AF-9
3	9606.ENSP00000252674	0.982	Protein ENL
4	9606.ENSP00000247843	0.962	YEATS domain-containing protein 4
5	9606.ENSP00000378578	0.922	AF4/FMR2 family member 1
6	9606.ENSP00000016946	0.840	RANBP2-like and GRIP domain containing 5
7	9606.ENSP00000262809	0.829	RNA polymerase II elongation factor ELL
8	9606.ENSP00000414516	0.778	Protein SSXT
9	9606.ENSP00000377015	0.764	Phosphatidylinositol-binding clathrin assembly protein
10	9606.ENSP00000375960	0.757	Afadin
11	9606.ENSP00000272369	0.745	Homeobox protein Meis1
12	9606.ENSP00000348769	0.733	E3 ubiquitin-protein ligase ARIH2
13	9606.ENSP00000436786	0.732	Histone-lysine N-methyltransferase 2A
14	9606.ENSP00000343619	0.718	Homeobox protein Hox-A9
15	9606.ENSP00000265343	0.660	AF4/FMR2 family member 4
16	9606.ENSP00000330842	0.648	RANBP2-like and GRIP domain-containing protein 5/6
17	9606.ENSP00000316032	0.641	Nuclear pore complex protein Nup98-Nup96
18	9606.ENSP00000366179	0.637	DnaJ homolog subfamily C member 1
19	9606.ENSP00000336712	0.629	Transportin-1
20	9606.ENSP00000306637	0.628	RANBP2-like and GRIP domain-containing protein 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003682	0.998	chromatin binding
GO:0044877	0.995	protein-containing complex binding
GO:0031491	0.990	nucleosome binding
GO:0042393	0.840	histone binding
GO:0140110	0.542	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0019219	0.986	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.981	regulation of DNA-templated transcription
GO:0071704	0.970	organic substance metabolic process
GO:0048522	0.966	positive regulation of cellular process
GO:0044238	0.960	primary metabolic process
GO:0044237	0.954	cellular metabolic process
GO:0018205	0.939	peptidyl-lysine modification
GO:0009893	0.934	positive regulation of metabolic process
GO:0051173	0.919	positive regulation of nitrogen compound metabolic process
GO:0010604	0.919	positive regulation of macromolecule metabolic process
GO:0016570	0.910	histone modification
GO:0031325	0.897	positive regulation of cellular metabolic process
GO:0018022	0.857	peptidyl-lysine methylation
GO:0016571	0.840	histone methylation
GO:0045935	0.839	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.790	positive regulation of DNA-templated transcription
GO:0034968	0.751	histone lysine methylation
GO:0006357	0.629	regulation of transcription by RNA polymerase II
GO:0032501	0.622	multicellular organismal process
GO:0050896	0.464	response to stimulus
GO:0045944	0.453	positive regulation of transcription by RNA polymerase II
GO:0051716	0.322	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0005737	0.717	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]