StarFunc result for job id P55198

User Input

>input (1093 residues)
MKEMVGGCCVCSDERGWAENPLVYCDGHACSVAVHQACYGIVQVPTGPWFCRKCESQERA
ARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVLTMEPIVLQYVPHDRFNKTC
YICEEQGRESKAASGACMTCNRHGCRQAFHVTCAQMAGLLCEEEVLEVDNVKYCGYCKYH
FSKMKTSRHSSGGGGGGAGGGGGSMGGGGSGFISGRRSRSASPSTQQEKHPTHHERGQKK
SRKDKERLKQKHKKRPESPPSILTPPVVPTADKVSSSASSSSHHEASTQETSESSRESKG
KKSSSHSLSHKGKKLSSGKGVSSFTSASSSSSSSSSSSGGPFQPAVSSLQSSPDFSAFPK
LEQPEEDKYSKPTAPAPSAPPSPSAPEPPKADLFEQKVVFSGFGPIMRFSTTTSSSGRAR
APSPGDYKSPHVTGSGASAGTHKRMPALSATPVPADETPETGLKEKKHKASKRSRHGPGR
PKGSRNKEGTGGPAAPSLPSAQLAGFTATAASPFSGGSLVSSGLGGLSSRTFGPSGSLPS
LSLESPLLGAGIYTSNKDPISHSGGMLRAVCSTPLSSSLLGPPGTSALPRLSRSPFTSTL
PSSSASISTTQVFSLAGSTFSLPSTHIFGTPMGAVNPLLSQAESSHTEPDLEDCSFRCRG
TSPQESLSSMSPISSLPALFDQTASAPCGGGQLDPAAPGTTNMEQLLEKQGDGEAGVNIV
EMLKALHALQKENQRLQEQILSLTAKKERLQILNVQLSVPFPALPAALPAANGPVPGPYG
LPPQAGSSDSLSTSKSPPGKSSLGLDNSLSTSSEDPHSGCPSRSSSSLSFHSTPPPLPLL
QQSPATLPLALPGAPAPLPPQPQNGLGRAPGAAGLGAMPMAEGLLGGLAGSGGLPLNGLL
GGLNGAAAPNPASLSQAGGAPTLQLPGCLNSLTEQQRHLLQQQEQQLQQLQQLLASPQLT
PEHQTVVYQMIQQIQQKRELQRLQMAGGSQLPMASLLAGSSTPLLSAGTPGLLPTASAPP
LLPAGALVAPSLGNNTSLMAAAAAAAAVAAAGGPPVLTAQTNPFLSLSGAEGSGGGPKGG
TADKGASANQEKG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1AR09	0.230	0.233	0.000	1079	0.909	0.921	B1AR09.pdb.gz	B1AR09_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
2	AFDB:B1AR10	0.308	0.304	0.000	1109	0.934	0.921	B1AR10.pdb.gz	B1AR10_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
3	AFDB:O54826	0.201	0.205	4.687E-58	1068	0.419	0.429	O54826.pdb.gz	AF10_MOUSE Protein AF-10 OS=Mus musculus OX=10090 GN=Mllt10 PE=1 SV=2
4	AFDB:F8W2W1	0.180	0.183	4.640E-55	1078	0.377	0.382	F8W2W1.pdb.gz
5	AFDB:F8W451	0.189	0.184	1.200E-51	1133	0.371	0.358	F8W451.pdb.gz	F8W451_DANRE MLLT10 histone lysine methyltransferase DOT1L cofactor OS=Danio rerio OX=7955 GN=mllt10 PE=4 SV=1
6	AFDB:A0A2R8RZV0	0.175	0.180	2.164E-48	1059	0.346	0.357	A0A2R8RZV0.pdb.gz
7	AFDB:A0A0B4KGP1	0.177	0.114	4.286E-31	1717	0.280	0.178	A0A0B4KGP1.pdb.gz	A0A0B4KGP1_DROME Alhambra, isoform P OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
8	AFDB:Q7KMH9	0.048	0.041	1.632E-5	1420	0.146	0.113	Q7KMH9.pdb.gz	Q7KMH9_DROME BcDNA.LD26050 OS=Drosophila melanogaster OX=7227 GN=wde PE=1 SV=1
9	AFDB:A2A6A1	0.046	0.038	9.292E-5	1505	0.150	0.109	A2A6A1.pdb.gz	GPTC8_MOUSE G patch domain-containing protein 8 OS=Mus musculus OX=10090 GN=Gpatch8 PE=1 SV=1
10	AFDB:Q8IHQ2	0.038	0.034	1.557E-3	1301	0.091	0.076	Q8IHQ2.pdb.gz	Q8IHQ2_PLAF7 Oocyst rupture protein 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1146600 PE=3 SV=1
11	PDB:5znxA	0.028	0.209	1.448	95	0.006	0.074	5znxA.pdb.gz
12	PDB:7emfK	0.047	0.268	2.484	112	0.008	0.080	7emfK.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
13	PDB:6jmiA	0.026	0.196	2.801	100	0.004	0.040	6jmiA.pdb.gz
14	PDB:1tjlA	0.039	0.277	2.974	145	0.009	0.069	1tjlA.pdb.gz	Regulation through the secondary channel--structural framework for ppGpp-DksA synergism during transcription
15	PDB:5n9jV	0.052	0.468	2.974	99	0.010	0.111	5n9jV.pdb.gz
16	PDB:4djhB	0.028	0.058	3.353	448	0.004	0.009	4djhB.pdb.gz	tructure of the human kappa-opioid receptor in complex with JDTic
17	PDB:1r1uC	0.026	0.197	3.560	98	0.004	0.041	1r1uC.pdb.gz
18	PDB:6v8oO	0.042	0.105	4.014	384	0.013	0.036	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
19	PDB:5apnh	0.039	0.193	4.262	119	0.013	0.118	5apnh.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
20	PDB:5k1yD	0.027	0.217	4.262	92	0.004	0.043	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AR09	0.0	1540	1079	0.907	0.918	B1AR09_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
2	B1AR10	0.0	1558	1109	0.930	0.916	B1AR10_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
3	O54826	0.0	564	1068	0.421	0.431	AF10_MOUSE Protein AF-10 OS=Mus musculus OX=10090 GN=Mllt10 PE=1 SV=2
4	P55198	0.0	2169	1093	1.000	1.000	AF17_HUMAN Protein AF-17 OS=Homo sapiens OX=9606 GN=MLLT6 PE=1 SV=3
5	Q3UPK1	0.0	1229	946	0.785	0.907	Q3UPK1_MOUSE PHD-type domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Mllt6 PE=2 SV=1
6	Q6P2C6	0.0	594	325	0.252	0.846	Q6P2C6_HUMAN MLLT6 protein OS=Homo sapiens OX=9606 GN=MLLT6 PE=1 SV=1
7	Q8VHB4	0.0	1519	1079	0.898	0.909	Q8VHB4_MOUSE MLLT6 OS=Mus musculus OX=10090 GN=Mllt6 PE=2 SV=1
8	P55197	4.37e-126	414	1068	0.157	0.161	AF10_HUMAN Protein AF-10 OS=Homo sapiens OX=9606 GN=MLLT10 PE=1 SV=2
9	Q8CFR8	1.95e-118	368	291	0.253	0.948	Q8CFR8_MOUSE Mllt6 protein (Fragment) OS=Mus musculus OX=10090 GN=Mllt6 PE=2 SV=1
10	F8W451	1.03e-113	382	1133	0.172	0.166	F8W451_DANRE MLLT10 histone lysine methyltransferase DOT1L cofactor OS=Danio rerio OX=7955 GN=mllt10 PE=4 SV=1
11	Q7KSZ0	6.56e-101	349	1323	0.125	0.104	Q7KSZ0_DROME Alhambra OS=Drosophila melanogaster OX=7227 GN=Alh PE=2 SV=1
12	A0A0B4KFD2	7.09e-101	349	1332	0.125	0.103	A0A0B4KFD2_DROME Alhambra, isoform L OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
13	Q9VI63	8.30e-101	350	1376	0.125	0.100	Q9VI63_DROME AF10 OS=Drosophila melanogaster OX=7227 GN=Alh PE=2 SV=3
14	Q7YU77	8.80e-101	349	1374	0.125	0.100	Q7YU77_DROME SD04152p OS=Drosophila melanogaster OX=7227 GN=Alh PE=2 SV=1
15	A0A0B4KGB4	1.19e-100	349	1385	0.125	0.099	A0A0B4KGB4_DROME Alhambra, isoform K OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
16	A0A0B4KGP1	1.21e-100	352	1717	0.125	0.080	A0A0B4KGP1_DROME Alhambra, isoform P OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
17	Q962D1	1.07e-98	343	1321	0.124	0.103	Q962D1_DROME Zinc finger/leucine zipper protein DALF isoform C3 OS=Drosophila melanogaster OX=7227 GN=Alh PE=2 SV=1
18	P34447	4.81e-77	274	867	0.104	0.131	ZFP1_CAEEL Zinc finger protein zfp-1 OS=Caenorhabditis elegans OX=6239 GN=zfp-1 PE=1 SV=2
19	Q5JT35	6.78e-50	192	763	0.194	0.278	Q5JT35_HUMAN MLLT10 histone lysine methyltransferase DOT1L cofactor (Fragment) OS=Homo sapiens OX=9606 GN=MLLT10 PE=1 SV=2
20	P55201	3.27e-44	177	1214	0.079	0.071	BRPF1_HUMAN Peregrin OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00628 PHD	0.00014	33.0	PHD-finger
2	PF13831 PHD_2	1.6e-09	48.4	PHD-finger
3	PF13771 zf-HC5HC2H	1.9e-14	65.0	PHD-like zinc-binding domain
4	PF13832 zf-HC5HC2H_2	7.1e-27	105.1	PHD-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479910

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381657	0.979	Histone-lysine N-methyltransferase, H3 lysine-79 specific
2	9606.ENSP00000252674	0.945	Protein ENL
3	9606.ENSP00000369695	0.892	Protein AF-9
4	9606.ENSP00000262809	0.724	RNA polymerase II elongation factor ELL
5	9606.ENSP00000325240	0.724	LIM and SH3 domain protein 1
6	9606.ENSP00000262395	0.720	TNF receptor-associated factor 4
7	9606.ENSP00000375960	0.670	Afadin
8	9606.ENSP00000376056	0.658	Elongation factor 1-beta
9	9606.ENSP00000350359	0.652	Cyclic AMP-responsive element-binding protein 5
10	9606.ENSP00000366460	0.652	Plexin domain-containing protein 2
11	9606.ENSP00000378578	0.644	AF4/FMR2 family member 1
12	9606.ENSP00000263205	0.625	Mediator of RNA polymerase II transcription subunit 15
13	9606.ENSP00000436786	0.623	Histone-lysine N-methyltransferase 2A
14	9606.ENSP00000357917	0.618	Protein AF1q
15	9606.ENSP00000413625	0.615	Formin-binding protein 1
16	9606.ENSP00000365637	0.597	Sickle tail protein homolog
17	9606.ENSP00000247843	0.588	YEATS domain-containing protein 4
18	9606.ENSP00000265807	0.574	SH2 domain-containing protein 4A
19	9606.ENSP00000265343	0.552	AF4/FMR2 family member 4
20	9606.ENSP00000482548	0.549	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042393	0.998	histone binding
GO:0003682	0.997	chromatin binding
GO:0031491	0.992	nucleosome binding
GO:0140110	0.476	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0080090	0.995	regulation of primary metabolic process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0048518	0.991	positive regulation of biological process
GO:0006355	0.991	regulation of DNA-templated transcription
GO:0009987	0.989	cellular process
GO:0071704	0.987	organic substance metabolic process
GO:0044238	0.984	primary metabolic process
GO:0006807	0.956	nitrogen compound metabolic process
GO:0048522	0.955	positive regulation of cellular process
GO:0044237	0.952	cellular metabolic process
GO:0019538	0.949	protein metabolic process
GO:0036211	0.944	protein modification process
GO:0006357	0.925	regulation of transcription by RNA polymerase II
GO:0010604	0.905	positive regulation of macromolecule metabolic process
GO:0032501	0.884	multicellular organismal process
GO:0031325	0.879	positive regulation of cellular metabolic process
GO:0051173	0.869	positive regulation of nitrogen compound metabolic process
GO:0045893	0.863	positive regulation of DNA-templated transcription
GO:0048519	0.839	negative regulation of biological process
GO:0016570	0.834	histone modification
GO:0018205	0.829	peptidyl-lysine modification
GO:0048523	0.813	negative regulation of cellular process
GO:0006479	0.735	protein methylation
GO:0034968	0.717	histone lysine methylation
GO:0030104	0.683	water homeostasis
GO:0070293	0.625	renal absorption
GO:0007588	0.620	excretion
GO:0031324	0.611	negative regulation of cellular metabolic process
GO:0045944	0.604	positive regulation of transcription by RNA polymerase II
GO:0097254	0.593	renal tubular secretion
GO:0050878	0.591	regulation of body fluid levels
GO:0051172	0.584	negative regulation of nitrogen compound metabolic process
GO:0010605	0.556	negative regulation of macromolecule metabolic process
GO:0051246	0.533	regulation of protein metabolic process
GO:0031399	0.503	regulation of protein modification process
GO:0140962	0.461	multicellular organismal-level chemical homeostasis
GO:0035809	0.461	regulation of urine volume
GO:0031056	0.461	regulation of histone modification
GO:0050891	0.424	multicellular organismal-level water homeostasis
GO:0051179	0.409	localization
GO:0051234	0.325	establishment of localization
GO:0032879	0.321	regulation of localization
GO:0006810	0.317	transport
GO:0051049	0.310	regulation of transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.881	protein-containing complex
GO:0005737	0.623	cytoplasm
GO:0043228	0.375	non-membrane-bounded organelle
GO:0043232	0.373	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]