StarFunc result for job id P55199

User Input

>input (621 residues)
MAALKEDRSYGLSCGRVSDGSKVSVFHVKLTDSALRAFESYRARQDSVSLRPSIRFQGSQ
GHISIPQPDCPAEARTFSFYLSNIGRDNPQGSFDCIQQYVSSHGEVHLDCLGSIQDKITV
CATDDSYQKARQSMAQAEEETRSRSAIVIKAGGRYLGKKVQFRKPAPGATDAVPSRKRAT
PINLASAIRKSGASAVSGGSGVSQRPFRDRVLHLLALRPYRKAELLLRLQKDGLTQADKD
ALDGLLQQVANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTGS
LLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQPAVNGKLGVPN
GREALLPTPGPPASTDTLSSSTHLPPRLEPPRAHDPLADVSNDLGHSGRDCEHGEAAAPA
PTVRLGLPLLTDCAQPSRPHGSPSRSKPKKKSKKHKDKERAAEDKPRAQLPDCAPATHAT
PGAPADTPGLNGTCSVSSVPTSTSETPDYLLKYAAISSSEQRQSYKNDFNAEYSEYRDLH
ARIERITRRFTQLDAQLRQLSQGSEEYETTRGQILQEYRKIKKTNTNYSQEKHRCEYLHS
KLAHIKRLIAEYDQRQLQAWP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55199	0.999	0.999	4.732E-93	621	1.000	1.000	P55199.pdb.gz	ELL_HUMAN RNA polymerase II elongation factor ELL OS=Homo sapiens OX=9606 GN=ELL PE=1 SV=1
2	AFDB:O08856	0.260	0.267	4.576E-73	602	0.812	0.837	O08856.pdb.gz	ELL_MOUSE RNA polymerase II elongation factor ELL OS=Mus musculus OX=10090 GN=Ell PE=2 SV=2
3	AFDB:O00472	0.216	0.210	3.566E-52	640	0.490	0.475	O00472.pdb.gz	ELL2_HUMAN RNA polymerase II elongation factor ELL2 OS=Homo sapiens OX=9606 GN=ELL2 PE=1 SV=2
4	PDB:7okxM	0.191	0.775	2.938E-14	139	0.132	0.590	7okxM.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
5	PDB:6o9lT	0.163	0.313	2.589E-4	237	0.050	0.131	6o9lT.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
6	PDB:7o4iR	0.137	0.243	2.460E-3	268	0.064	0.149	7o4iR.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
7	PDB:5fywR	0.108	0.241	3.817E-3	199	0.042	0.131	5fywR.pdb.gz	Transcription Initiation Complex Structures Elucidate DNA Opening
8	PDB:5svag	0.135	0.401	5.307E-3	172	0.035	0.128	5svag.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
9	PDB:7edxT	0.115	0.466	1.426E-2	113	0.024	0.133	7edxT.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
10	AFDB:P91278	0.104	0.173	2.233E-2	362	0.097	0.166	P91278.pdb.gz	FOXF_CAEEL Forkhead box protein F OS=Caenorhabditis elegans OX=6239 GN=let-381 PE=1 SV=2
11	PDB:7d58N	0.103	0.347	3.076E-2	136	0.014	0.066	7d58N.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
12	PDB:7edxG	0.123	0.455	3.076E-2	145	0.024	0.103	7edxG.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
13	PDB:7z1lN	0.103	0.307	4.048E-2	153	0.029	0.118	7z1lN.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
14	AFDB:O95886	0.078	0.059	4.559E-2	979	0.179	0.113	O95886.pdb.gz	DLGP3_HUMAN Disks large-associated protein 3 OS=Homo sapiens OX=9606 GN=DLGAP3 PE=1 SV=3
15	PDB:7a6hN	0.106	0.283	4.773E-2	186	0.014	0.048	7a6hN.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
16	AFDB:Q54CD2	0.065	0.059	4.816E-2	716	0.084	0.073	Q54CD2.pdb.gz	Q54CD2_DICDI Kelch repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293044 PE=4 SV=1
17	AFDB:A8JFU2	0.060	0.021	5.376E-2	2118	0.121	0.035	A8JFU2.pdb.gz	CFA65_CHLRE Cilia- and flagella-associated protein 65 (Fragment) OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP65 PE=1 SV=1
18	AFDB:Q5ALV2	0.055	0.036	7.074E-2	1257	0.118	0.058	Q5ALV2.pdb.gz	SLA1_CANAL Actin cytoskeleton-regulatory complex protein SLA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SLA1 PE=1 SV=1
19	AFDB:A0A087WZ40	0.065	0.054	8.341E-2	779	0.137	0.109	A0A087WZ40.pdb.gz	A0A087WZ40_HUMAN Microtubule associated protein 7 OS=Homo sapiens OX=9606 GN=MAP7 PE=1 SV=1
20	AFDB:G5E8Z2	0.069	0.056	8.341E-2	850	0.158	0.115	G5E8Z2.pdb.gz	TAF4B_MOUSE Transcription initiation factor TFIID subunit 4B OS=Mus musculus OX=10090 GN=Taf4b PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00472	0.0	535	640	0.488	0.473	ELL2_HUMAN RNA polymerase II elongation factor ELL2 OS=Homo sapiens OX=9606 GN=ELL2 PE=1 SV=2
2	O08856	0.0	940	602	0.813	0.839	ELL_MOUSE RNA polymerase II elongation factor ELL OS=Mus musculus OX=10090 GN=Ell PE=2 SV=2
3	P55199	0.0	1271	621	1.000	1.000	ELL_HUMAN RNA polymerase II elongation factor ELL OS=Homo sapiens OX=9606 GN=ELL PE=1 SV=1
4	Q6PEG4	0.0	673	633	0.596	0.585	Q6PEG4_DANRE Elongation factor RNA polymerase II OS=Danio rerio OX=7955 GN=wu:fc60b11 PE=1 SV=1
5	U3KQ90	0.0	995	488	0.786	1.000	U3KQ90_HUMAN Elongation factor for RNA polymerase II OS=Homo sapiens OX=9606 GN=ELL PE=1 SV=2
6	Q80VR2	5.26e-31	127	395	0.089	0.139	ELL3_MOUSE RNA polymerase II elongation factor ELL3 OS=Mus musculus OX=10090 GN=Ell3 PE=1 SV=1
7	Q9HB65	2.90e-29	122	397	0.093	0.146	ELL3_HUMAN RNA polymerase II elongation factor ELL3 OS=Homo sapiens OX=9606 GN=ELL3 PE=1 SV=2
8	M9YY17	5.24e-21	99.4	569	0.081	0.088	M9YY17_ONCMY Tricellulin (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
9	Q3UZP0	5.15e-17	87.0	555	0.095	0.106	MALD2_MOUSE MARVEL domain-containing protein 2 OS=Mus musculus OX=10090 GN=Marveld2 PE=1 SV=1
10	A1BQX2	9.03e-17	85.5	442	0.071	0.100	A1BQX2_HUMAN MARVEL domain containing 2 OS=Homo sapiens OX=9606 GN=MARVELD2 PE=1 SV=1
11	Q9VW51	1.88e-16	85.9	1059	0.076	0.044	ELL_DROME RNA polymerase II elongation factor Ell OS=Drosophila melanogaster OX=7227 GN=Ell PE=1 SV=3
12	Q8N4S9	2.07e-16	85.1	558	0.071	0.079	MALD2_HUMAN MARVEL domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MARVELD2 PE=1 SV=2
13	Q6P6T5	1.12e-14	79.3	523	0.066	0.078	OCLN_RAT Occludin OS=Rattus norvegicus OX=10116 GN=Ocln PE=1 SV=1
14	Q61146	4.48e-14	77.4	521	0.063	0.075	OCLN_MOUSE Occludin OS=Mus musculus OX=10090 GN=Ocln PE=1 SV=1
15	Q6PP84	8.60e-14	76.3	449	0.113	0.156	Q6PP84_BOVIN Occludin (Fragment) OS=Bos taurus OX=9913 GN=OCLN PE=2 SV=1
16	A2VE81	1.65e-13	75.9	522	0.108	0.128	A2VE81_BOVIN Occludin OS=Bos taurus OX=9913 GN=OCLN PE=2 SV=1
17	Q16625	4.59e-13	74.3	522	0.108	0.128	OCLN_HUMAN Occludin OS=Homo sapiens OX=9606 GN=OCLN PE=1 SV=1
18	Q28269	6.34e-13	73.9	521	0.060	0.071	OCLN_CANLF Occludin OS=Canis lupus familiaris OX=9615 GN=OCLN PE=1 SV=1
19	C9JHD8	2.21e-10	62.8	206	0.055	0.165	C9JHD8_HUMAN Elongation factor for RNA polymerase II 3 (Fragment) OS=Homo sapiens OX=9606 GN=ELL3 PE=1 SV=1
20	Q9PUN1	1.27e-08	60.1	493	0.090	0.114	OCLN_XENLA Occludin OS=Xenopus laevis OX=8355 GN=ocln PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11932 DUF3450	55	14.5	Protein of unknown function (DUF3450)
2	PF19683 DUF6185	2.3e+02	11.3	Family of unknown function (DUF6185)
3	PF10390 ELL	5.3e-108	372.3	RNA polymerase II elongation factor ELL
4	PF07303 Occludin_ELL	2.1e-29	113.5	Occludin homology domain
5	PF10443 RNA12	91	13.2	RNA12 protein
6	PF12072 RNase_Y_N	1.1e+02	13.7	RNase Y N-terminal region
7	PF12325 TMF_TATA_bd	7.6e+02	11.6	TATA element modulatory factor 1 TATA binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262809

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265343	0.998	AF4/FMR2 family member 4
2	9606.ENSP00000273668	0.995	ELL-associated factor 2
3	9606.ENSP00000369695	0.995	Protein AF-9
4	9606.ENSP00000252674	0.994	Protein ENL
5	9606.ENSP00000380054	0.991	ELL-associated factor 1
6	9606.ENSP00000296564	0.979	Little elongation complex subunit 1
7	9606.ENSP00000378578	0.964	AF4/FMR2 family member 1
8	9606.ENSP00000421380	0.963	Vacuolar-sorting protein SNF8
9	9606.ENSP00000263253	0.958	Histone acetyltransferase p300
10	9606.ENSP00000261900	0.953	Cyclin-T1
11	9606.ENSP00000261520	0.940	Little elongation complex subunit 2
12	9606.ENSP00000361918	0.917	Peptidyl-prolyl cis-trans isomerase E
13	9606.ENSP00000362361	0.914	Cyclin-dependent kinase 9
14	9606.ENSP00000227524	0.913	Pre-mRNA-processing factor 19
15	9606.ENSP00000343535	0.913	Ubiquitin carboxyl-terminal hydrolase 7
16	9606.ENSP00000320346	0.910	RNA polymerase II elongation factor ELL3
17	9606.ENSP00000351137	0.907	Pre-mRNA-splicing factor SYF1
18	9606.ENSP00000374501	0.905	UV-stimulated scaffold protein A
19	9606.ENSP00000301764	0.902	DNA damage-binding protein 1
20	9606.ENSP00000370125	0.901	Non-histone chromosomal protein HMG-14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019902	1.000	phosphatase binding
GO:0003676	0.384	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0090304	0.992	nucleic acid metabolic process
GO:0010467	0.985	gene expression
GO:0006366	0.975	transcription by RNA polymerase II
GO:0050794	0.971	regulation of cellular process
GO:0019222	0.964	regulation of metabolic process
GO:0060255	0.953	regulation of macromolecule metabolic process
GO:0080090	0.949	regulation of primary metabolic process
GO:0051171	0.949	regulation of nitrogen compound metabolic process
GO:0031323	0.949	regulation of cellular metabolic process
GO:0048518	0.926	positive regulation of biological process
GO:0010468	0.905	regulation of gene expression
GO:0051252	0.897	regulation of RNA metabolic process
GO:0048522	0.845	positive regulation of cellular process
GO:0032784	0.844	regulation of DNA-templated transcription elongation
GO:0010604	0.792	positive regulation of macromolecule metabolic process
GO:0051173	0.780	positive regulation of nitrogen compound metabolic process
GO:0031325	0.777	positive regulation of cellular metabolic process
GO:0006368	0.775	transcription elongation by RNA polymerase II
GO:0051254	0.771	positive regulation of RNA metabolic process
GO:0032786	0.757	positive regulation of DNA-templated transcription, elongation
GO:0098781	0.689	ncRNA transcription
GO:0016073	0.677	snRNA metabolic process
GO:0006383	0.657	transcription by RNA polymerase III
GO:0006357	0.452	regulation of transcription by RNA polymerase II
GO:0045944	0.348	positive regulation of transcription by RNA polymerase II
GO:0034243	0.301	regulation of transcription elongation by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0016604	0.998	nuclear body
GO:0008023	0.995	transcription elongation factor complex
GO:0043232	0.986	intracellular non-membrane-bounded organelle
GO:0005694	0.844	chromosome
GO:0000785	0.712	chromatin
GO:0016607	0.663	nuclear speck
GO:0035363	0.485	histone locus body
GO:0000791	0.454	euchromatin
GO:0015030	0.410	Cajal body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]