StarFunc result for job id P55201

User Input

>input (1214 residues)
MGVDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDNPPPPQQTPLRK
HKKKGRQSRPANKQSPSPSEVSQSPGREVMSYAQAQRMVEVDLHGRVHRISIFDNLDVVS
EDEEAPEEAPENGSNKENTETPAATPKSGKHKNKEKRKDSNHHHHHNVSASTTPKLPEVV
YRELEQDTPDAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNERRKTEGVSPI
PQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAV
HQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEV
CFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLY
MKMEPVRETGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEDEDEEEDEGKGWSS
EKVKKAKAKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRL
HSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQVGRDSEDKNWALKEQLKSWQRLRHDLER
ARLLVELIRKREKLKRETIKVQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLS
EVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVR
LREQGGAVLRQARRQAEKMGIDFETGMHIPHSLAGDEATHHTEDAAEEERLVLLENQKHL
PVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPS
SRGSLTPHPAACDKDGQTDSAAEESSSQETSKGLGPNMSSTPAHEVGRRTSVLFSKKNPK
TAGPPKRPGRPPKNRESQMTPSHGGSPVGPPQLPIMSSLRQRKRGRSPRPSSSSDSDSDK
STEDPPMDLPANGFSGGNQPVKKSFLVYRNDCSLPRSSSDSESSSSSSSSAASDRTSTTP
SKQGRGKPSFSRGTFPEDSSEDTSGTENEAYSVGTGRGVGHSMVRKSLGRGAGWLSEDED
SPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEARE
HLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRS
KVQGEQSSETSDSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A5F9ZH11	0.345	0.337	0.000	1253	0.998	0.966	A0A5F9ZH11.pdb.gz	A0A5F9ZH11_HUMAN Bromodomain and PHD finger containing 1 OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
2	AFDB:B2YCZ4	0.424	0.414	0.000	1258	0.744	0.718	B2YCZ4.pdb.gz
3	AFDB:H9GXF8	0.234	0.229	0.000	1248	0.636	0.619	H9GXF8.pdb.gz
4	AFDB:P55201	1.000	1.000	0.000	1214	1.000	1.000	P55201.pdb.gz	BRPF1_HUMAN Peregrin OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
5	AFDB:A0A024R4V5	0.290	0.295	2.417E-99	1189	0.484	0.494	A0A024R4V5.pdb.gz
6	AFDB:Q7JVP4	0.217	0.188	1.381E-84	1430	0.429	0.364	Q7JVP4.pdb.gz	BRDH_DROME Bromodomain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=Br140 PE=1 SV=1
7	AFDB:A0A0B4KGP1	0.139	0.100	9.248E-13	1717	0.129	0.091	A0A0B4KGP1.pdb.gz	A0A0B4KGP1_DROME Alhambra, isoform P OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
8	AFDB:Q9NSI6	0.084	0.045	4.147E-5	2320	0.070	0.037	Q9NSI6.pdb.gz	BRWD1_HUMAN Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=BRWD1 PE=1 SV=4
9	AFDB:O88509	0.074	0.102	2.221E-4	859	0.053	0.075	O88509.pdb.gz	DNM3B_MOUSE DNA (cytosine-5)-methyltransferase 3B OS=Mus musculus OX=10090 GN=Dnmt3b PE=1 SV=2
10	AFDB:P79149	0.051	0.072	4.627E-4	773	0.085	0.133	P79149.pdb.gz	PININ_CANLF Pinin OS=Canis lupus familiaris OX=9615 GN=PNN PE=2 SV=3
11	PDB:1keyB	0.053	0.225	2.277E-1	221	0.021	0.113	1keyB.pdb.gz
12	PDB:3pjaL	0.058	0.226	6.499E-1	223	0.021	0.117	3pjaL.pdb.gz
13	PDB:7pzyn	0.043	0.243	6.499E-1	155	0.012	0.097	7pzyn.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
14	PDB:5datS4	0.035	0.144	7.607E-1	260	0.011	0.050	5datS4.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
15	PDB:3axjA	0.054	0.176	1.042	225	0.026	0.138	3axjA.pdb.gz
16	PDB:5datl6	0.045	0.262	1.042	157	0.014	0.108	5datl6.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
17	PDB:4v8mBv	0.046	0.276	1.285	157	0.010	0.076	4v8mBv.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
18	PDB:7w59R	0.027	0.099	1.285	280	0.030	0.129	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
19	PDB:7egdF	0.046	0.083	1.670	412	0.021	0.061	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
20	PDB:4v6iBN	0.045	0.290	2.060	138	0.012	0.109	4v6iBN.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A5F9ZH11	0.0	2498	1253	0.998	0.967	A0A5F9ZH11_HUMAN Bromodomain and PHD finger containing 1 OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
2	B2RRD7	0.0	2484	1212	0.982	0.983	BRPF1_MOUSE Peregrin OS=Mus musculus OX=10090 GN=Brpf1 PE=1 SV=1
3	D3ZUW8	0.0	929	1189	0.386	0.394	D3ZUW8_RAT Bromodomain containing 1 OS=Rattus norvegicus OX=10116 GN=Brd1 PE=4 SV=3
4	G5E8P1	0.0	927	1058	0.386	0.443	BRD1_MOUSE Bromodomain-containing protein 1 OS=Mus musculus OX=10090 GN=Brd1 PE=1 SV=1
5	O95696	0.0	892	1058	0.383	0.440	BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens OX=9606 GN=BRD1 PE=1 SV=1
6	P55201	0.0	2530	1214	1.000	1.000	BRPF1_HUMAN Peregrin OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
7	Q7JVP4	0.0	726	1430	0.319	0.271	BRDH_DROME Bromodomain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=Br140 PE=1 SV=1
8	Q803M2	0.0	1267	899	0.525	0.709	Q803M2_DANRE Bromodomain and PHD finger containing, 1 OS=Danio rerio OX=7955 GN=zgc:55530 PE=2 SV=1
9	Q9ULD4	0.0	873	1205	0.380	0.383	BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens OX=9606 GN=BRPF3 PE=1 SV=2
10	O74759	1.19e-67	246	767	0.130	0.206	NTO1_SCHPO Mst2 complex subunit nto1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nto1 PE=1 SV=1
11	Q12311	1.67e-66	242	748	0.114	0.186	NTO1_YEAST NuA3 HAT complex component NTO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTO1 PE=1 SV=1
12	Q803A0	4.03e-60	224	829	0.117	0.171	JADE1_DANRE Protein Jade-1 OS=Danio rerio OX=7955 GN=jade1 PE=2 SV=1
13	Q92613	3.12e-59	222	823	0.115	0.170	JADE3_HUMAN Protein Jade-3 OS=Homo sapiens OX=9606 GN=JADE3 PE=1 SV=1
14	Q7YZH1	2.81e-57	221	3241	0.129	0.048	RNO_DROME PHD finger protein rhinoceros OS=Drosophila melanogaster OX=7227 GN=rno PE=1 SV=1
15	Q6IE81	9.60e-57	214	842	0.125	0.181	JADE1_HUMAN Protein Jade-1 OS=Homo sapiens OX=9606 GN=JADE1 PE=1 SV=1
16	Q9NQC1	7.43e-54	205	790	0.111	0.171	JADE2_HUMAN E3 ubiquitin-protein ligase Jade-2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=2
17	A0A0C4DFT8	7.65e-54	205	791	0.111	0.171	A0A0C4DFT8_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=1
18	A0A087X085	1.04e-53	205	833	0.110	0.160	A0A087X085_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=2
19	Q6ZQF7	1.05e-53	205	829	0.109	0.159	JADE2_MOUSE E3 ubiquitin-protein ligase Jade-2 OS=Mus musculus OX=10090 GN=Jade2 PE=1 SV=2
20	G3XAA4	1.06e-53	205	834	0.110	0.159	G3XAA4_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00439 Bromodomain	3e-19	80.2	Bromodomain
2	PF10513 EPL1	7e-31	119.5	Enhancer of polycomb-like
3	PF00628 PHD	4.6e-05	34.6	PHD-finger
4	PF13831 PHD_2	1.7e-11	54.6	PHD-finger
5	PF00855 PWWP	4.1e-11	54.6	PWWP domain
6	PF13771 zf-HC5HC2H	2.1e-22	90.5	PHD-like zinc-binding domain
7	PF13832 zf-HC5HC2H_2	7.8e-34	127.5	PHD-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000008038

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000014290	0.948	K(lysine) acetyltransferase 6A
2	9544.ENSMMUP00000013534	0.929	Chromatin modification-related protein MEAF6
3	9544.ENSMMUP00000030926	0.922	K(lysine) acetyltransferase 6B
4	9544.ENSMMUP00000022341	0.921	Inhibitor of growth protein
5	9544.ENSMMUP00000022340	0.871	Inhibitor of growth family, member 4
6	9544.ENSMMUP00000039192	0.833	Belongs to the histone H3 family.
7	9544.ENSMMUP00000041394	0.833	Histone H3
8	9544.ENSMMUP00000039157	0.797	Uncharacterized protein
9	9544.ENSMMUP00000002715	0.763	K(lysine) acetyltransferase 8
10	9544.ENSMMUP00000026085	0.763	Histone acetyltransferase
11	9544.ENSMMUP00000024594	0.757	Chromodomain helicase DNA binding protein 4
12	9544.ENSMMUP00000029252	0.757	Chromodomain helicase DNA binding protein 3
13	9544.ENSMMUP00000034157	0.755	Bromodomain PHD finger transcription factor
14	9544.ENSMMUP00000030046	0.749	Inhibitor of growth protein
15	9544.ENSMMUP00000001937	0.747	Belongs to the histone H2A family.
16	9544.ENSMMUP00000009519	0.742	Histone H2A
17	9544.ENSMMUP00000001933	0.729	Belongs to the histone H2A family.
18	9544.ENSMMUP00000031276	0.729	Belongs to the histone H2A family.
19	9544.ENSMMUP00000003467	0.725	Belongs to the histone H2A family.
20	9544.ENSMMUP00000011716	0.724	Histone deacetylase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0098772	1.000	molecular function regulator activity
GO:0005515	1.000	protein binding
GO:0010485	1.000	histone H4 acetyltransferase activity
GO:0008047	0.994	enzyme activator activity
GO:0042393	0.907	histone binding
GO:0043996	0.823	histone H4K8 acetyltransferase activity
GO:0043995	0.823	histone H4K5 acetyltransferase activity
GO:0043997	0.820	histone H4K12 acetyltransferase activity
GO:0010698	0.776	acetyltransferase activator activity
GO:0140110	0.440	transcription regulator activity
GO:0140030	0.417	modification-dependent protein binding
GO:0010484	0.402	histone H3 acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.987	biological regulation
GO:0050794	0.981	regulation of cellular process
GO:0071704	0.954	organic substance metabolic process
GO:0044238	0.946	primary metabolic process
GO:0006807	0.912	nitrogen compound metabolic process
GO:0043170	0.911	macromolecule metabolic process
GO:0019222	0.881	regulation of metabolic process
GO:0080090	0.874	regulation of primary metabolic process
GO:0051171	0.874	regulation of nitrogen compound metabolic process
GO:0031323	0.874	regulation of cellular metabolic process
GO:0060255	0.872	regulation of macromolecule metabolic process
GO:1901564	0.867	organonitrogen compound metabolic process
GO:0019219	0.863	regulation of nucleobase-containing compound metabolic process
GO:0016573	0.860	histone acetylation
GO:0043966	0.853	histone H3 acetylation
GO:0048518	0.833	positive regulation of biological process
GO:0031326	0.831	regulation of cellular biosynthetic process
GO:0010556	0.830	regulation of macromolecule biosynthetic process
GO:0010468	0.816	regulation of gene expression
GO:2001141	0.815	regulation of RNA biosynthetic process
GO:0048522	0.786	positive regulation of cellular process
GO:0006355	0.786	regulation of DNA-templated transcription
GO:0010604	0.706	positive regulation of macromolecule metabolic process
GO:0051173	0.688	positive regulation of nitrogen compound metabolic process
GO:0031325	0.687	positive regulation of cellular metabolic process
GO:0009987	0.671	cellular process
GO:0045935	0.659	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.501	positive regulation of DNA-templated transcription
GO:0032502	0.407	developmental process
GO:0032501	0.392	multicellular organismal process
GO:0048856	0.375	anatomical structure development
GO:0007275	0.346	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0000785	0.997	chromatin
GO:0005737	0.996	cytoplasm
GO:0005829	0.994	cytosol
GO:0032991	0.990	protein-containing complex
GO:0016020	0.983	membrane
GO:0071944	0.957	cell periphery
GO:1902494	0.915	catalytic complex
GO:0005886	0.910	plasma membrane
GO:1990234	0.877	transferase complex
GO:0140535	0.707	intracellular protein-containing complex
GO:0000123	0.698	histone acetyltransferase complex
GO:0070775	0.623	H3 histone acetyltransferase complex
GO:0070776	0.328	MOZ/MORF histone acetyltransferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21992	1.000	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	1.000	histone acetyltransferase.

[back to server]