StarFunc result for job id P55209

User Input

>input (391 residues)
MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLV
ETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEI
INAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDL
LSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPD
DSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNF
FAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEE
ADEEGEEEGDEENDPDYDPKKDQNPAECKQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P28656	0.802	0.802	1.712E-65	391	0.982	0.982	P28656.pdb.gz	NP1L1_MOUSE Nucleosome assembly protein 1-like 1 OS=Mus musculus OX=10090 GN=Nap1l1 PE=1 SV=2
2	AFDB:Q7ZY81	0.755	0.751	5.675E-61	393	0.885	0.880	Q7ZY81.pdb.gz	NPL1B_XENLA Nucleosome assembly protein 1-like 1-B OS=Xenopus laevis OX=8355 GN=nap1l1-b PE=1 SV=1
3	AFDB:B9ELD5	0.736	0.724	2.050E-59	398	0.857	0.842	B9ELD5.pdb.gz	B9ELD5_SALSA Nucleosome assembly protein 1-like 1 OS=Salmo salar OX=8030 GN=NP1L1 PE=2 SV=1
4	AFDB:Q5U2Z3	0.704	0.712	1.967E-48	386	0.634	0.642	Q5U2Z3.pdb.gz	NP1L4_RAT Nucleosome assembly protein 1-like 4 OS=Rattus norvegicus OX=10116 GN=Nap1l4 PE=1 SV=1
5	AFDB:A0A2R8Q4J7	0.676	0.735	2.201E-41	359	0.542	0.591	A0A2R8Q4J7.pdb.gz	A0A2R8Q4J7_DANRE Nucleosome assembly protein 1-like 4 isoform X1 OS=Danio rerio OX=7955 GN=cb910 PE=1 SV=1
6	PDB:7un6B	0.595	0.959	7.674E-38	240	0.609	0.992	7un6B.pdb.gz
7	AFDB:Q24150	0.640	0.675	3.751E-35	370	0.445	0.470	Q24150.pdb.gz	Q24150_DROME Nucleosome assembly protein NAP-1 OS=Drosophila melanogaster OX=7227 GN=Nap1 PE=1 SV=1
8	AFDB:C8V9B5	0.639	0.613	2.541E-31	409	0.366	0.350	C8V9B5.pdb.gz	C8V9B5_EMENI Nucleosome assembly protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08863 PE=3 SV=1
9	AFDB:P51860	0.620	0.531	2.832E-30	460	0.430	0.365	P51860.pdb.gz	NP1L2_MOUSE Nucleosome assembly protein 1-like 2 OS=Mus musculus OX=10090 GN=Nap1l2 PE=1 SV=2
10	AFDB:Q9ULW6	0.619	0.530	5.409E-30	460	0.445	0.378	Q9ULW6.pdb.gz	NP1L2_HUMAN Nucleosome assembly protein 1-like 2 OS=Homo sapiens OX=9606 GN=NAP1L2 PE=1 SV=1
11	AFDB:P78920	0.619	0.636	1.470E-29	379	0.322	0.332	P78920.pdb.gz	YGNB_SCHPO Putative nucleosome assembly protein C2D10.11C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2D10.11c PE=2 SV=2
12	PDB:6n2gA	0.595	0.806	1.261E-27	285	0.325	0.446	6n2gA.pdb.gz
13	PDB:6k09A	0.574	0.829	4.557E-26	267	0.307	0.449	6k09A.pdb.gz
14	PDB:2ayuA	0.600	0.814	8.979E-23	283	0.263	0.364	2ayuA.pdb.gz
15	PDB:3fs3A	0.405	0.762	5.758E-13	197	0.184	0.365	3fs3A.pdb.gz
16	PDB:5gpkB	0.391	0.679	3.270E-9	207	0.166	0.314	5gpkB.pdb.gz
17	PDB:7c7xE	0.347	0.716	4.654E-9	174	0.141	0.316	7c7xE.pdb.gz
18	PDB:3q66A	0.321	0.475	2.643E-5	236	0.123	0.203	3q66A.pdb.gz
19	PDB:3c7nA	0.100	0.070	3.659E-2	649	0.056	0.034	3c7nA.pdb.gz	Structure of the Hsp110:Hsc70 nucleotide exchange machine
20	PDB:1ifvA	0.122	0.233	1.790E-1	155	0.043	0.110	1ifvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5DGT5	0.0	525	383	0.803	0.820	B5DGT5_SALSA Nucleosome assembly protein 1, like 1 OS=Salmo salar OX=8030 PE=2 SV=1
2	B5DGT6	0.0	520	396	0.803	0.793	B5DGT6_SALSA Nucleosome assembly protein 1, like 1 OS=Salmo salar OX=8030 PE=2 SV=1
3	B5X2G0	0.0	538	393	0.821	0.817	B5X2G0_SALSA Nucleosome assembly protein 1-like 1 OS=Salmo salar OX=8030 GN=NP1L1 PE=2 SV=1
4	B9ELD5	0.0	544	398	0.829	0.814	B9ELD5_SALSA Nucleosome assembly protein 1-like 1 OS=Salmo salar OX=8030 GN=NP1L1 PE=2 SV=1
5	B9EPV8	0.0	537	394	0.826	0.820	B9EPV8_SALSA Nucleosome assembly protein 1-like 1 OS=Salmo salar OX=8030 GN=NP1L1 PE=2 SV=1
6	P28656	0.0	783	391	0.982	0.982	NP1L1_MOUSE Nucleosome assembly protein 1-like 1 OS=Mus musculus OX=10090 GN=Nap1l1 PE=1 SV=2
7	P55209	0.0	792	391	1.000	1.000	NP1L1_HUMAN Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1 PE=1 SV=1
8	Q4U0Y4	0.0	533	392	0.859	0.857	NPL1A_XENLA Nucleosome assembly protein 1-like 1-A OS=Xenopus laevis OX=8355 GN=nap1l1-a PE=1 SV=1
9	Q7ZY81	0.0	551	393	0.854	0.850	NPL1B_XENLA Nucleosome assembly protein 1-like 1-B OS=Xenopus laevis OX=8355 GN=nap1l1-b PE=1 SV=1
10	Q803X7	0.0	516	385	0.765	0.777	Q803X7_DANRE Nap1l1 protein OS=Danio rerio OX=7955 GN=cb716 PE=1 SV=1
11	Q9Z2G8	0.0	771	390	0.972	0.974	NP1L1_RAT Nucleosome assembly protein 1-like 1 OS=Rattus norvegicus OX=10116 GN=Nap1l1 PE=1 SV=1
12	Q78ZA7	1.56e-158	452	375	0.578	0.603	NP1L4_MOUSE Nucleosome assembly protein 1-like 4 OS=Mus musculus OX=10090 GN=Nap1l4 PE=1 SV=1
13	Q5U2Z3	7.61e-158	451	386	0.629	0.637	NP1L4_RAT Nucleosome assembly protein 1-like 4 OS=Rattus norvegicus OX=10116 GN=Nap1l4 PE=1 SV=1
14	Q99733	1.88e-151	434	375	0.570	0.595	NP1L4_HUMAN Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1
15	A0A2R8Q4J7	7.40e-128	374	359	0.522	0.568	A0A2R8Q4J7_DANRE Nucleosome assembly protein 1-like 4 isoform X1 OS=Danio rerio OX=7955 GN=cb910 PE=1 SV=1
16	A4QP71	4.75e-126	369	349	0.473	0.530	A4QP71_DANRE Nap1l4a protein OS=Danio rerio OX=7955 GN=cb910 PE=1 SV=1
17	Q9ULW6	3.35e-102	312	460	0.419	0.357	NP1L2_HUMAN Nucleosome assembly protein 1-like 2 OS=Homo sapiens OX=9606 GN=NAP1L2 PE=1 SV=1
18	Q24150	3.74e-102	308	370	0.389	0.411	Q24150_DROME Nucleosome assembly protein NAP-1 OS=Drosophila melanogaster OX=7227 GN=Nap1 PE=1 SV=1
19	Q9W1G7	4.30e-102	308	370	0.389	0.411	Q9W1G7_DROME LD21576p OS=Drosophila melanogaster OX=7227 GN=Nap1 PE=1 SV=1
20	P51860	2.68e-97	299	460	0.414	0.352	NP1L2_MOUSE Nucleosome assembly protein 1-like 2 OS=Mus musculus OX=10090 GN=Nap1l2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00956 NAP	2.9e-108	372.7	Nucleosome assembly protein (NAP)
2	PF17800 NPL	2.9e+02	13.5	Nucleoplasmin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477538

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296417	0.920	Histone H2A.Z
2	9606.ENSP00000384302	0.917	WD repeat-containing protein 43
3	9606.ENSP00000263253	0.897	Histone acetyltransferase p300
4	9606.ENSP00000296930	0.893	Nucleophosmin
5	9606.ENSP00000369915	0.883	Nucleosome assembly protein 1-like 4
6	9606.ENSP00000354742	0.878	Importin-9
7	9606.ENSP00000434024	0.827	Histone H2AX
8	9606.ENSP00000308405	0.825	Histone H2A.V
9	9606.ENSP00000348596	0.825	Protein SDA1 homolog
10	9606.ENSP00000362613	0.818	Homeobox protein CDX-4
11	9606.ENSP00000217244	0.810	Casein kinase II subunit alpha
12	9606.ENSP00000368927	0.805	Eukaryotic translation initiation factor 1A, X-chromosomal
13	9606.ENSP00000364209	0.800	Melanoma-associated antigen D2
14	9606.ENSP00000346725	0.799	Pescadillo homolog
15	9606.ENSP00000376946	0.789	Bardet-Biedl syndrome 10 protein
16	9606.ENSP00000358151	0.787	Histone H2B type 2-E
17	9606.ENSP00000365042	0.747	Casein kinase II subunit beta
18	9606.ENSP00000303423	0.730	Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
19	9606.ENSP00000351589	0.726	Histone cluster 1 H2A family member i
20	9606.ENSP00000332194	0.722	Histone H2A type 2-C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042393	0.943	histone binding
GO:0097159	0.835	organic cyclic compound binding
GO:0003676	0.718	nucleic acid binding
GO:0003723	0.368	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050789	0.984	regulation of biological process
GO:0044238	0.981	primary metabolic process
GO:0050794	0.974	regulation of cellular process
GO:0071704	0.973	organic substance metabolic process
GO:0044237	0.959	cellular metabolic process
GO:0034728	0.950	nucleosome organization
GO:0065004	0.940	protein-DNA complex assembly
GO:0006807	0.908	nitrogen compound metabolic process
GO:0006334	0.905	nucleosome assembly
GO:0080090	0.895	regulation of primary metabolic process
GO:0043170	0.863	macromolecule metabolic process
GO:0060255	0.792	regulation of macromolecule metabolic process
GO:0051171	0.789	regulation of nitrogen compound metabolic process
GO:0010604	0.780	positive regulation of macromolecule metabolic process
GO:0046483	0.755	heterocycle metabolic process
GO:0048522	0.723	positive regulation of cellular process
GO:0031323	0.655	regulation of cellular metabolic process
GO:0009889	0.628	regulation of biosynthetic process
GO:0010556	0.618	regulation of macromolecule biosynthetic process
GO:0034641	0.572	cellular nitrogen compound metabolic process
GO:0050896	0.539	response to stimulus
GO:0010468	0.500	regulation of gene expression
GO:0031326	0.496	regulation of cellular biosynthetic process
GO:0019219	0.487	regulation of nucleobase-containing compound metabolic process
GO:0050793	0.449	regulation of developmental process
GO:1901360	0.408	organic cyclic compound metabolic process
GO:0032502	0.379	developmental process
GO:0048519	0.378	negative regulation of biological process
GO:0051239	0.363	regulation of multicellular organismal process
GO:0042127	0.362	regulation of cell population proliferation
GO:0048856	0.355	anatomical structure development
GO:2000026	0.354	regulation of multicellular organismal development
GO:0032501	0.345	multicellular organismal process
GO:0048523	0.324	negative regulation of cellular process
GO:0044260	0.323	cellular macromolecule metabolic process
GO:0045595	0.312	regulation of cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.999	cytoplasm
GO:0016020	0.984	membrane
GO:0031981	0.965	nuclear lumen
GO:0043232	0.946	intracellular non-membrane-bounded organelle
GO:0005654	0.928	nucleoplasm
GO:0032991	0.900	protein-containing complex
GO:0005829	0.649	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]