StarFunc result for job id P55211

User Input

>input (416 residues)
MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLII
DLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEV
LRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTR
TGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQ
ASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVAS
TSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSG
SWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55211	1.000	1.000	2.146E-85	416	1.000	1.000	P55211.pdb.gz	CASP9_HUMAN Caspase-9 OS=Homo sapiens OX=9606 GN=CASP9 PE=1 SV=3
2	AFDB:Q8C3Q9	0.781	0.718	3.756E-65	454	0.786	0.720	Q8C3Q9.pdb.gz	CASP9_MOUSE Caspase-9 OS=Mus musculus OX=10090 GN=Casp9 PE=1 SV=1
3	AFDB:F1NL59	0.610	0.607	5.566E-52	418	0.550	0.548	F1NL59.pdb.gz
4	AFDB:A0A2U9DQQ3	0.653	0.627	4.363E-47	436	0.483	0.461	A0A2U9DQQ3.pdb.gz
5	AFDB:Q90WU0	0.605	0.624	3.053E-45	403	0.493	0.509	Q90WU0.pdb.gz	Q90WU0_CHICK Caspase 9 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
6	AFDB:A0A288CG41	0.597	0.570	1.574E-36	437	0.296	0.281	A0A288CG41.pdb.gz	A0A288CG41_DANRE Caspase 2 OS=Danio rerio OX=7955 GN=casp2 PE=2 SV=1
7	AFDB:Q9IB67	0.556	0.547	4.045E-36	423	0.288	0.284	Q9IB67.pdb.gz	Q9IB67_XENLA Caspase 2 L homeolog OS=Xenopus laevis OX=8355 GN=casp2.L PE=1 SV=1
8	AFDB:P29594	0.548	0.505	4.821E-35	452	0.293	0.270	P29594.pdb.gz	CASP2_MOUSE Caspase-2 OS=Mus musculus OX=10090 GN=Casp2 PE=1 SV=5
9	AFDB:P42575	0.548	0.505	3.002E-34	452	0.288	0.265	P42575.pdb.gz	CASP2_HUMAN Caspase-2 OS=Homo sapiens OX=9606 GN=CASP2 PE=1 SV=2
10	AFDB:P42573	0.598	0.503	1.033E-31	503	0.281	0.233	P42573.pdb.gz	CED3_CAEEL Cell death protein 3 OS=Caenorhabditis elegans OX=6239 GN=ced-3 PE=1 SV=2
11	PDB:4pryA	0.534	0.884	8.966E-26	249	0.216	0.361	4pryA.pdb.gz	Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
12	PDB:4fdlB	0.511	0.884	7.956E-25	239	0.200	0.347	4fdlB.pdb.gz
13	PDB:4nblA	0.505	0.800	7.039E-22	258	0.202	0.326	4nblA.pdb.gz	Tailoring small molecules for an allosteric site on procaspase-6.
14	PDB:4iyrB	0.416	0.880	6.595E-18	191	0.166	0.361	4iyrB.pdb.gz
15	PDB:7wzsB	0.434	0.852	1.504E-16	206	0.175	0.354	7wzsB.pdb.gz
16	PDB:2wdpD	0.427	0.749	3.436E-16	230	0.178	0.322	2wdpD.pdb.gz
17	PDB:6w8rA	0.428	0.485	1.482E-6	364	0.089	0.102	6w8rA.pdb.gz
18	PDB:5nijA	0.346	0.338	7.277E-5	428	0.070	0.068	5nijA.pdb.gz
19	PDB:4af8A	0.347	0.417	3.181E-4	333	0.094	0.117	4af8A.pdb.gz
20	PDB:5juyB	0.211	0.073	4.272E-4	1234	0.077	0.026	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P55211	0.0	855	416	1.000	1.000	CASP9_HUMAN Caspase-9 OS=Homo sapiens OX=9606 GN=CASP9 PE=1 SV=3
2	Q8C3Q9	0.0	642	454	0.786	0.720	CASP9_MOUSE Caspase-9 OS=Mus musculus OX=10090 GN=Casp9 PE=1 SV=1
3	Q9JHK1	0.0	613	454	0.781	0.716	Q9JHK1_RAT Caspase-9 OS=Rattus norvegicus OX=10116 GN=Casp9 PE=1 SV=1
4	Q90WU0	5.18e-130	382	403	0.498	0.514	Q90WU0_CHICK Caspase 9 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
5	F1QSB1	2.73e-125	371	436	0.502	0.479	F1QSB1_DANRE Caspase 9, apoptosis-related cysteine peptidase OS=Danio rerio OX=7955 GN=im:7136887 PE=1 SV=1
6	A0A0G2K3V0	7.85e-78	243	243	0.365	0.626	A0A0G2K3V0_RAT Caspase 9 OS=Rattus norvegicus OX=10116 GN=Casp9 PE=1 SV=2
7	Q9IB67	1.18e-45	164	423	0.296	0.291	Q9IB67_XENLA Caspase 2 L homeolog OS=Xenopus laevis OX=8355 GN=casp2.L PE=1 SV=1
8	P42574	2.19e-45	160	277	0.219	0.329	CASP3_HUMAN Caspase-3 OS=Homo sapiens OX=9606 GN=CASP3 PE=1 SV=2
9	Q0PKX3	2.98e-45	164	435	0.310	0.297	Q0PKX3_DANRE Caspase 2, apoptosis-related cysteine peptidase OS=Danio rerio OX=7955 GN=casp2 PE=2 SV=1
10	Q95ND5	3.16e-45	159	277	0.212	0.318	CASP3_PIG Caspase-3 OS=Sus scrofa OX=9823 GN=CASP3 PE=1 SV=1
11	Q9JHX4	3.75e-45	164	482	0.255	0.220	CASP8_RAT Caspase-8 OS=Rattus norvegicus OX=10116 GN=Casp8 PE=1 SV=1
12	P70677	8.78e-45	158	277	0.216	0.325	CASP3_MOUSE Caspase-3 OS=Mus musculus OX=10090 GN=Casp3 PE=1 SV=1
13	A0A288CG41	1.42e-44	162	437	0.312	0.297	A0A288CG41_DANRE Caspase 2 OS=Danio rerio OX=7955 GN=casp2 PE=2 SV=1
14	P55213	1.19e-43	155	277	0.212	0.318	CASP3_RAT Caspase-3 OS=Rattus norvegicus OX=10116 GN=Casp3 PE=2 SV=2
15	F1NV61	1.32e-42	154	309	0.212	0.285	CASP7_CHICK Caspase-7 OS=Gallus gallus OX=9031 GN=CASP7 PE=3 SV=2
16	O93417	9.26e-42	150	283	0.214	0.314	O93417_CHICK Caspase-3 OS=Gallus gallus OX=9031 GN=CASP3 PE=1 SV=1
17	Q8MKI5	1.34e-41	150	277	0.212	0.318	CASP3_CANLF Caspase-3 OS=Canis lupus familiaris OX=9615 GN=CASP3 PE=2 SV=1
18	Q98UI8	3.48e-41	149	282	0.207	0.305	Q98UI8_DANRE Caspase 3, apoptosis-related cysteine peptidase a OS=Danio rerio OX=7955 GN=casp3 PE=1 SV=1
19	H0Z8H6	4.43e-41	149	282	0.204	0.301	H0Z8H6_TAEGU Caspase 3 OS=Taeniopygia guttata OX=59729 GN=CASP3 PE=3 SV=2
20	Q4ZHV0	8.71e-41	148	279	0.212	0.315	Q4ZHV0_SALSA Caspase 3B OS=Salmo salar OX=8030 GN=CASP3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09010 AsiA	6.7e+02	11.8	Anti-Sigma Factor A
2	PF00619 CARD	4e-15	66.9	Caspase recruitment domain
3	PF16739 CARD_2	33	15.9	Caspase recruitment domain
4	PF00656 Peptidase_C14	1.6e-36	137.8	Caspase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330237

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307786	0.999	Cytochrome c
2	9606.ENSP00000360242	0.999	E3 ubiquitin-protein ligase XIAP
3	9606.ENSP00000448165	0.999	Apoptotic protease-activating factor 1
4	9606.ENSP00000263464	0.997	Baculoviral IAP repeat-containing protein 3
5	9606.ENSP00000477613	0.997	Baculoviral IAP repeat-containing protein 2
6	9606.ENSP00000398495	0.995	Diablo homolog, mitochondrial
7	9606.ENSP00000412957	0.990	Baculoviral IAP repeat-containing protein 8
8	9606.ENSP00000311032	0.988	Caspase-3
9	9606.ENSP00000451828	0.984	RAC-alpha serine/threonine-protein kinase
10	9606.ENSP00000217169	0.982	Baculoviral IAP repeat-containing protein 7
11	9606.ENSP00000302564	0.973	Bcl-2-like protein 1
12	9606.ENSP00000263025	0.970	Mitogen-activated protein kinase 3
13	9606.ENSP00000215832	0.966	Mitogen-activated protein kinase 1
14	9606.ENSP00000346437	0.955	Ubiquitin-like modifier-activating enzyme ATG7
15	9606.ENSP00000355759	0.949	Poly [ADP-ribose] polymerase 1
16	9606.ENSP00000306822	0.947	Cell death regulator Aven
17	9606.ENSP00000358327	0.943	Caspase-7
18	9606.ENSP00000375892	0.941	RAC-beta serine/threonine-protein kinase
19	9606.ENSP00000263826	0.939	RAC-gamma serine/threonine-protein kinase
20	9606.ENSP00000389140	0.938	Netrin receptor DCC

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004197	1.000	cysteine-type endopeptidase activity
GO:0042802	0.976	identical protein binding
GO:0140677	0.955	molecular function activator activity
GO:0019899	0.934	enzyme binding
GO:0030234	0.927	enzyme regulator activity
GO:0008047	0.922	enzyme activator activity
GO:0097153	0.895	cysteine-type endopeptidase activity involved in apoptotic process
GO:0019904	0.890	protein domain specific binding
GO:0019901	0.613	protein kinase binding
GO:0017124	0.502	SH3 domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.996	cellular process
GO:0048518	0.995	positive regulation of biological process
GO:0071704	0.992	organic substance metabolic process
GO:0050794	0.992	regulation of cellular process
GO:0006915	0.988	apoptotic process
GO:0051716	0.986	cellular response to stimulus
GO:0043170	0.984	macromolecule metabolic process
GO:0048522	0.983	positive regulation of cellular process
GO:0044238	0.978	primary metabolic process
GO:0009893	0.975	positive regulation of metabolic process
GO:0080090	0.974	regulation of primary metabolic process
GO:0060255	0.974	regulation of macromolecule metabolic process
GO:0006807	0.973	nitrogen compound metabolic process
GO:0051171	0.973	regulation of nitrogen compound metabolic process
GO:0006508	0.960	proteolysis
GO:0010941	0.957	regulation of cell death
GO:2001056	0.957	positive regulation of cysteine-type endopeptidase activity
GO:0006950	0.947	response to stress
GO:0043280	0.944	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0042981	0.938	regulation of apoptotic process
GO:0043065	0.932	positive regulation of apoptotic process
GO:0032502	0.916	developmental process
GO:0048856	0.904	anatomical structure development
GO:0007154	0.809	cell communication
GO:0048583	0.809	regulation of response to stimulus
GO:0006919	0.800	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0007165	0.767	signal transduction
GO:0035556	0.701	intracellular signal transduction
GO:0009628	0.697	response to abiotic stimulus
GO:0010467	0.690	gene expression
GO:0033554	0.686	cellular response to stress
GO:0030154	0.603	cell differentiation
GO:0051604	0.600	protein maturation
GO:0009411	0.578	response to UV
GO:0016485	0.567	protein processing
GO:0006974	0.566	cellular response to DNA damage stimulus
GO:0032501	0.555	multicellular organismal process
GO:0031323	0.546	regulation of cellular metabolic process
GO:0048519	0.522	negative regulation of biological process
GO:0104004	0.511	cellular response to environmental stimulus
GO:0042221	0.508	response to chemical
GO:0010033	0.451	response to organic substance
GO:0097190	0.451	apoptotic signaling pathway
GO:0070887	0.437	cellular response to chemical stimulus
GO:0080134	0.392	regulation of response to stress
GO:0048523	0.392	negative regulation of cellular process
GO:0044237	0.361	cellular metabolic process
GO:0010646	0.356	regulation of cell communication
GO:0023051	0.334	regulation of signaling
GO:0071310	0.327	cellular response to organic substance
GO:0048584	0.323	positive regulation of response to stimulus
GO:0007275	0.315	multicellular organism development
GO:0009966	0.314	regulation of signal transduction
GO:0071840	0.303	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0032991	0.994	protein-containing complex
GO:0043226	0.958	organelle
GO:0043231	0.942	intracellular membrane-bounded organelle
GO:0005634	0.826	nucleus
GO:1902494	0.792	catalytic complex
GO:0016020	0.731	membrane
GO:1905368	0.691	peptidase complex
GO:1905369	0.666	endopeptidase complex
GO:0008303	0.663	caspase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	1.000	Cysteine endopeptidases.

[back to server]