StarFunc result for job id P55212

User Input

>input (293 residues)
MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLT
LPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLS
HGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDN
QTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYG
SSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55212	1.000	1.000	1.339E-62	293	1.000	1.000	P55212.pdb.gz	CASP6_HUMAN Caspase-6 OS=Homo sapiens OX=9606 GN=CASP6 PE=1 SV=2
2	AFDB:O35397	0.901	0.953	5.158E-54	277	0.829	0.877	O35397.pdb.gz	CASP6_RAT Caspase-6 OS=Rattus norvegicus OX=10116 GN=Casp6 PE=2 SV=2
3	AFDB:A0A1D5PPP7	0.874	0.843	2.539E-47	304	0.689	0.664	A0A1D5PPP7.pdb.gz	CASP6_CHICK Caspase-6 OS=Gallus gallus OX=9031 GN=CASP6 PE=2 SV=2
4	PDB:4nblA	0.800	0.906	1.811E-46	258	0.877	0.996	4nblA.pdb.gz	Tailoring small molecules for an allosteric site on procaspase-6.
5	PDB:2wdpD	0.692	0.867	1.642E-34	230	0.785	1.000	2wdpD.pdb.gz
6	AFDB:O01382	0.774	0.671	1.547E-32	339	0.379	0.327	O01382.pdb.gz	DRICE_DROME Caspase OS=Drosophila melanogaster OX=7227 GN=Drice PE=1 SV=2
7	AFDB:Q4ZHV0	0.775	0.814	1.547E-32	279	0.375	0.394	Q4ZHV0.pdb.gz	Q4ZHV0_SALSA Caspase 3B OS=Salmo salar OX=8030 GN=CASP3 PE=2 SV=1
8	PDB:4iyrB	0.639	0.975	1.839E-32	191	0.642	0.984	4iyrB.pdb.gz
9	AFDB:P42574	0.778	0.822	7.759E-32	277	0.365	0.386	P42574.pdb.gz	CASP3_HUMAN Caspase-3 OS=Homo sapiens OX=9606 GN=CASP3 PE=1 SV=2
10	AFDB:H0Z8H6	0.780	0.809	9.282E-32	282	0.358	0.372	H0Z8H6.pdb.gz	H0Z8H6_TAEGU Caspase 3 OS=Taeniopygia guttata OX=59729 GN=CASP3 PE=3 SV=2
11	AFDB:O02002	0.811	0.738	1.410E-31	323	0.365	0.331	O02002.pdb.gz	CASP1_DROME Caspase-1 OS=Drosophila melanogaster OX=7227 GN=Dcp-1 PE=1 SV=1
12	AFDB:F1NV61	0.769	0.730	1.497E-31	309	0.365	0.346	F1NV61.pdb.gz	CASP7_CHICK Caspase-7 OS=Gallus gallus OX=9031 GN=CASP7 PE=3 SV=2
13	AFDB:Q8MKI5	0.780	0.825	1.790E-31	277	0.362	0.383	Q8MKI5.pdb.gz	CASP3_CANLF Caspase-3 OS=Canis lupus familiaris OX=9615 GN=CASP3 PE=2 SV=1
14	PDB:4pryA	0.772	0.905	2.321E-30	249	0.362	0.426	4pryA.pdb.gz	Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
15	PDB:4fdlB	0.764	0.934	1.269E-28	239	0.324	0.397	4fdlB.pdb.gz
16	PDB:7wzsB	0.653	0.922	3.626E-20	206	0.297	0.422	7wzsB.pdb.gz
17	PDB:4af8A	0.431	0.387	1.370E-5	333	0.126	0.111	4af8A.pdb.gz
18	PDB:4fguA	0.466	0.348	2.210E-5	407	0.096	0.069	4fguA.pdb.gz
19	PDB:5nijA	0.513	0.368	9.835E-5	428	0.106	0.072	5nijA.pdb.gz
20	PDB:6w8rA	0.512	0.419	1.010E-3	364	0.116	0.093	6w8rA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08738	0.0	526	276	0.850	0.902	CASP6_MOUSE Caspase-6 OS=Mus musculus OX=10090 GN=Casp6 PE=1 SV=1
2	O35397	0.0	515	277	0.829	0.877	CASP6_RAT Caspase-6 OS=Rattus norvegicus OX=10116 GN=Casp6 PE=2 SV=2
3	P55212	0.0	616	293	1.000	1.000	CASP6_HUMAN Caspase-6 OS=Homo sapiens OX=9606 GN=CASP6 PE=1 SV=2
4	A0A1D5PPP7	6.82e-155	436	304	0.686	0.661	CASP6_CHICK Caspase-6 OS=Gallus gallus OX=9031 GN=CASP6 PE=2 SV=2
5	F1NV61	1.17e-65	209	309	0.369	0.350	CASP7_CHICK Caspase-7 OS=Gallus gallus OX=9031 GN=CASP7 PE=3 SV=2
6	P42574	5.49e-65	207	277	0.362	0.383	CASP3_HUMAN Caspase-3 OS=Homo sapiens OX=9606 GN=CASP3 PE=1 SV=2
7	Q8MKI5	3.73e-64	204	277	0.365	0.386	CASP3_CANLF Caspase-3 OS=Canis lupus familiaris OX=9615 GN=CASP3 PE=2 SV=1
8	Q95ND5	5.51e-63	201	277	0.362	0.383	CASP3_PIG Caspase-3 OS=Sus scrofa OX=9823 GN=CASP3 PE=1 SV=1
9	P70677	7.62e-63	201	277	0.362	0.383	CASP3_MOUSE Caspase-3 OS=Mus musculus OX=10090 GN=Casp3 PE=1 SV=1
10	Q4ZHV0	1.47e-62	201	279	0.365	0.384	Q4ZHV0_SALSA Caspase 3B OS=Salmo salar OX=8030 GN=CASP3 PE=2 SV=1
11	P55213	2.61e-62	200	277	0.358	0.379	CASP3_RAT Caspase-3 OS=Rattus norvegicus OX=10116 GN=Casp3 PE=2 SV=2
12	G3IL63	3.60e-60	195	303	0.345	0.333	G3IL63_CRIGR Caspase-7 OS=Cricetulus griseus OX=10029 GN=I79_024625 PE=1 SV=1
13	O93417	3.73e-59	192	283	0.365	0.378	O93417_CHICK Caspase-3 OS=Gallus gallus OX=9031 GN=CASP3 PE=1 SV=1
14	H0Z8H6	4.12e-59	192	282	0.365	0.379	H0Z8H6_TAEGU Caspase 3 OS=Taeniopygia guttata OX=59729 GN=CASP3 PE=3 SV=2
15	A0A0G2K9Z4	9.88e-59	191	291	0.341	0.344	A0A0G2K9Z4_RAT Caspase 7 OS=Rattus norvegicus OX=10116 GN=Casp7 PE=1 SV=1
16	A0A8I5ZQU7	1.39e-58	191	301	0.341	0.332	A0A8I5ZQU7_RAT Caspase 7 OS=Rattus norvegicus OX=10116 GN=Casp7 PE=3 SV=1
17	O01382	8.40e-58	190	339	0.365	0.316	DRICE_DROME Caspase OS=Drosophila melanogaster OX=7227 GN=Drice PE=1 SV=2
18	Q98UI8	2.00e-57	187	282	0.341	0.355	Q98UI8_DANRE Caspase 3, apoptosis-related cysteine peptidase a OS=Danio rerio OX=7955 GN=casp3 PE=1 SV=1
19	P97864	8.23e-57	186	303	0.334	0.323	CASP7_MOUSE Caspase-7 OS=Mus musculus OX=10090 GN=Casp7 PE=1 SV=2
20	P55210	1.60e-56	186	303	0.334	0.323	CASP7_HUMAN Caspase-7 OS=Homo sapiens OX=9606 GN=CASP7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00656 Peptidase_C14	2.2e-38	143.8	Caspase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265164

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000284981	0.981	Amyloid-beta A4 protein
2	9606.ENSP00000448165	0.980	Apoptotic protease-activating factor 1
3	9606.ENSP00000311032	0.975	Caspase-3
4	9606.ENSP00000351273	0.973	Caspase-8
5	9606.ENSP00000399518	0.971	DNA-binding protein SATB1
6	9606.ENSP00000357283	0.960	Prelamin-A/C
7	9606.ENSP00000261366	0.957	Lamin-B1
8	9606.ENSP00000269305	0.956	Cellular tumor antigen p53
9	9606.ENSP00000477613	0.953	Baculoviral IAP repeat-containing protein 2
10	9606.ENSP00000327054	0.950	Lamin-B2
11	9606.ENSP00000263464	0.946	Baculoviral IAP repeat-containing protein 3
12	9606.ENSP00000354522	0.946	DNA topoisomerase 1
13	9606.ENSP00000373487	0.934	Keratin, type I cytoskeletal 18
14	9606.ENSP00000358525	0.929	Beta-nerve growth factor
15	9606.ENSP00000414303	0.929	Brain-derived neurotrophic factor
16	9606.ENSP00000446007	0.925	Vimentin
17	9606.ENSP00000312664	0.924	Caspase-2
18	9606.ENSP00000172229	0.923	Tumor necrosis factor receptor superfamily member 16
19	9606.ENSP00000330237	0.922	Caspase-9
20	9606.ENSP00000368924	0.922	Transcription factor AP-2-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097153	0.998	cysteine-type endopeptidase activity involved in apoptotic process
GO:0042802	0.922	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050896	0.990	response to stimulus
GO:0050794	0.989	regulation of cellular process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.980	primary metabolic process
GO:0006807	0.972	nitrogen compound metabolic process
GO:0048522	0.972	positive regulation of cellular process
GO:0043170	0.966	macromolecule metabolic process
GO:0010033	0.960	response to organic substance
GO:0019222	0.957	regulation of metabolic process
GO:0060255	0.951	regulation of macromolecule metabolic process
GO:0019538	0.951	protein metabolic process
GO:0010941	0.949	regulation of cell death
GO:0080090	0.948	regulation of primary metabolic process
GO:0051171	0.948	regulation of nitrogen compound metabolic process
GO:0006915	0.948	apoptotic process
GO:0006508	0.937	proteolysis
GO:0043065	0.935	positive regulation of apoptotic process
GO:0032502	0.929	developmental process
GO:0032501	0.926	multicellular organismal process
GO:0030162	0.913	regulation of proteolysis
GO:0048856	0.912	anatomical structure development
GO:0009893	0.911	positive regulation of metabolic process
GO:0010604	0.900	positive regulation of macromolecule metabolic process
GO:0052548	0.894	regulation of endopeptidase activity
GO:0007154	0.887	cell communication
GO:0051716	0.883	cellular response to stimulus
GO:0023052	0.850	signaling
GO:0051173	0.849	positive regulation of nitrogen compound metabolic process
GO:0048869	0.764	cellular developmental process
GO:0097190	0.742	apoptotic signaling pathway
GO:0030154	0.725	cell differentiation
GO:0044093	0.724	positive regulation of molecular function
GO:1901698	0.720	response to nitrogen compound
GO:0006950	0.710	response to stress
GO:0051247	0.694	positive regulation of protein metabolic process
GO:0045862	0.674	positive regulation of proteolysis
GO:0031323	0.659	regulation of cellular metabolic process
GO:2000116	0.650	regulation of cysteine-type endopeptidase activity
GO:0070887	0.643	cellular response to chemical stimulus
GO:0048583	0.624	regulation of response to stimulus
GO:0051345	0.623	positive regulation of hydrolase activity
GO:0010467	0.600	gene expression
GO:0071310	0.552	cellular response to organic substance
GO:0048584	0.544	positive regulation of response to stimulus
GO:0051604	0.542	protein maturation
GO:0016485	0.531	protein processing
GO:0035556	0.527	intracellular signal transduction
GO:0071840	0.505	cellular component organization or biogenesis
GO:0010950	0.502	positive regulation of endopeptidase activity
GO:0048519	0.488	negative regulation of biological process
GO:0080134	0.488	regulation of response to stress
GO:0014070	0.482	response to organic cyclic compound
GO:0016043	0.453	cellular component organization
GO:0030855	0.439	epithelial cell differentiation
GO:0048523	0.432	negative regulation of cellular process
GO:2001056	0.413	positive regulation of cysteine-type endopeptidase activity
GO:0044237	0.369	cellular metabolic process
GO:0071495	0.325	cellular response to endogenous stimulus
GO:0010468	0.320	regulation of gene expression
GO:0010243	0.316	response to organonitrogen compound
GO:0019219	0.301	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	0.999	nucleus
GO:0032991	0.995	protein-containing complex
GO:0005654	0.989	nucleoplasm
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:1902494	0.918	catalytic complex
GO:0016020	0.873	membrane
GO:1905368	0.706	peptidase complex
GO:1905369	0.692	endopeptidase complex
GO:0008303	0.669	caspase complex
GO:0005730	0.356	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	1.000	Cysteine endopeptidases.

[back to server]