StarFunc result for job id P55263

User Input

>input (362 residues)
MAAAEEEPKPKKLKVEAPQALRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAED
KHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKA
AEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKAR
VCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGN
ETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFA
VLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPD
FH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55263	1.000	1.000	1.583E-74	362	1.000	1.000	P55263.pdb.gz	ADK_HUMAN Adenosine kinase OS=Homo sapiens OX=9606 GN=ADK PE=1 SV=2
2	PDB:2i6aA	0.907	0.956	1.633E-62	343	0.942	0.994	2i6aA.pdb.gz	Crystal structures of human adenosine kinase inhibitor complexes reveal two distinct binding modes.
3	AFDB:A0A5K1VW94	0.834	0.848	1.219E-59	356	0.831	0.846	A0A5K1VW94.pdb.gz	A0A5K1VW94_HUMAN Adenosine kinase OS=Homo sapiens OX=9606 GN=ADK PE=1 SV=1
4	AFDB:Q9LZG0	0.928	0.974	8.440E-53	345	0.530	0.557	Q9LZG0.pdb.gz	ADK2_ARATH Adenosine kinase 2 OS=Arabidopsis thaliana OX=3702 GN=ADK2 PE=1 SV=1
5	AFDB:Q86NZ5	0.930	0.967	2.313E-47	348	0.492	0.511	Q86NZ5.pdb.gz	Q86NZ5_DROME Adenosine kinase (Fragment) OS=Drosophila melanogaster OX=7227 GN=Adk2 PE=2 SV=1
6	AFDB:A0A5F9ZH31	0.648	0.794	4.565E-47	294	0.702	0.864	A0A5F9ZH31.pdb.gz	A0A5F9ZH31_HUMAN Adenosine kinase OS=Homo sapiens OX=9606 GN=ADK PE=1 SV=1
7	AFDB:Q93934	0.923	0.977	2.231E-46	342	0.481	0.509	Q93934.pdb.gz	Q93934_CAEEL Adenosine kinase OS=Caenorhabditis elegans OX=6239 GN=adk-1 PE=1 SV=1
8	AFDB:A0A1D8PQ26	0.901	0.940	4.178E-43	347	0.398	0.415	A0A1D8PQ26.pdb.gz	A0A1D8PQ26_CANAL Adenosine kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ADO1 PE=3 SV=1
9	AFDB:P78825	0.875	0.931	1.722E-42	340	0.378	0.403	P78825.pdb.gz	ADK_SCHPO Adenosine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ado1 PE=2 SV=2
10	AFDB:Q54MB5	0.914	0.973	3.399E-42	340	0.378	0.403	Q54MB5.pdb.gz	ADK_DICDI Adenosine kinase OS=Dictyostelium discoideum OX=44689 GN=adk PE=3 SV=2
11	PDB:4n09A	0.916	0.960	8.885E-40	345	0.376	0.394	4n09A.pdb.gz	Structures of adenosine kinase from Trypanosoma brucei brucei.
12	AFDB:P47143	0.889	0.945	9.817E-40	340	0.362	0.385	P47143.pdb.gz	ADK_YEAST Adenosine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADO1 PE=1 SV=1
13	PDB:2c49A	0.650	0.777	1.047E-17	299	0.185	0.224	2c49A.pdb.gz	Structure of Methanocaldococcus Jannaschii Nucleoside Kinase: An Archaeal Member of the Ribokinase Family.
14	PDB:1gqtB	0.677	0.790	4.835E-17	307	0.199	0.235	1gqtB.pdb.gz	Activation of Ribokinase by Monovalent Cations.
15	PDB:2varA	0.689	0.794	1.197E-16	311	0.157	0.183	2varA.pdb.gz	The Structure of Sulfolobus Solfataricus 2-Keto-3-Deoxygluconate Kinase.
16	PDB:5bycA	0.653	0.735	1.267E-16	318	0.169	0.192	5bycA.pdb.gz
17	PDB:3in1A	0.655	0.751	9.202E-16	312	0.180	0.208	3in1A.pdb.gz	Crystal structure of a putative Ribokinase in complex with ADP from E.coli
18	PDB:6vwpA	0.763	0.645	1.031E-15	435	0.188	0.156	6vwpA.pdb.gz	ppGpp Coordinates Nucleotide and Amino-Acid Synthesis in E. coli During Starvation.
19	PDB:1v1aA	0.671	0.797	1.154E-15	301	0.166	0.199	1v1aA.pdb.gz	Structure of Thermus thermophilus 2-Keto-3-deoxygluconate kinase: evidence for recognition of an open chain substrate.
20	PDB:7vtdA	0.677	0.788	1.368E-15	307	0.146	0.173	7vtdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VJE0	0.0	715	345	0.942	0.988	A0A140VJE0_HUMAN Adenosine kinase OS=Homo sapiens OX=9606 PE=2 SV=1
2	A0A5F9ZH31	0.0	532	294	0.702	0.864	A0A5F9ZH31_HUMAN Adenosine kinase OS=Homo sapiens OX=9606 GN=ADK PE=1 SV=1
3	A0A5F9ZHJ1	0.0	566	270	0.746	1.000	A0A5F9ZHJ1_HUMAN Adenosine kinase OS=Homo sapiens OX=9606 GN=ADK PE=1 SV=1
4	A0A5K1VW54	0.0	671	347	0.892	0.931	A0A5K1VW54_HUMAN Adenosine kinase OS=Homo sapiens OX=9606 GN=ADK PE=1 SV=1
5	A0A5K1VW94	0.0	624	356	0.829	0.843	A0A5K1VW94_HUMAN Adenosine kinase OS=Homo sapiens OX=9606 GN=ADK PE=1 SV=1
6	P55262	0.0	696	361	0.912	0.914	ADK_CRIGR Adenosine kinase OS=Cricetulus griseus OX=10029 GN=ADK PE=1 SV=3
7	P55263	0.0	754	362	1.000	1.000	ADK_HUMAN Adenosine kinase OS=Homo sapiens OX=9606 GN=ADK PE=1 SV=2
8	P55264	0.0	697	361	0.909	0.911	ADK_MOUSE Adenosine kinase OS=Mus musculus OX=10090 GN=Adk PE=1 SV=2
9	Q64640	0.0	692	361	0.901	0.903	ADK_RAT Adenosine kinase OS=Rattus norvegicus OX=10116 GN=Adk PE=1 SV=3
10	Q9SF85	5.20e-147	421	344	0.541	0.570	ADK1_ARATH Adenosine kinase 1 OS=Arabidopsis thaliana OX=3702 GN=ADK1 PE=1 SV=1
11	Q9LZG0	1.00e-146	420	345	0.533	0.559	ADK2_ARATH Adenosine kinase 2 OS=Arabidopsis thaliana OX=3702 GN=ADK2 PE=1 SV=1
12	Q93934	6.28e-121	354	342	0.483	0.512	Q93934_CAEEL Adenosine kinase OS=Caenorhabditis elegans OX=6239 GN=adk-1 PE=1 SV=1
13	Q9VU38	3.47e-119	350	345	0.494	0.519	Q9VU38_DROME Adenosine kinase OS=Drosophila melanogaster OX=7227 GN=Adk2 PE=1 SV=1
14	Q86NZ5	3.48e-119	350	348	0.494	0.514	Q86NZ5_DROME Adenosine kinase (Fragment) OS=Drosophila melanogaster OX=7227 GN=Adk2 PE=2 SV=1
15	Q9VU39	4.14e-119	350	345	0.494	0.519	Q9VU39_DROME Adenosine kinase OS=Drosophila melanogaster OX=7227 GN=Adk2 PE=1 SV=1
16	A0A1D8PQ26	1.40e-91	280	347	0.401	0.418	A0A1D8PQ26_CANAL Adenosine kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ADO1 PE=3 SV=1
17	P78825	3.38e-88	271	340	0.384	0.409	ADK_SCHPO Adenosine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ado1 PE=2 SV=2
18	Q54MB5	4.40e-85	263	340	0.376	0.400	ADK_DICDI Adenosine kinase OS=Dictyostelium discoideum OX=44689 GN=adk PE=3 SV=2
19	Q584S0	3.49e-83	258	345	0.376	0.394	Q584S0_TRYB2 Adenosine kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.780 PE=1 SV=1
20	Q584S6	2.06e-82	256	345	0.376	0.394	Q584S6_TRYB2 Adenosine kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.700 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00294 PfkB	2.6e-73	258.6	pfkB family carbohydrate kinase
2	PF08543 Phos_pyr_kin	52	14.7	Phosphomethylpyrimidine kinase
3	PF18578 Raf1_N	4.6e+02	12.8	Rubisco accumulation factor 1 alpha helical domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286621

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361965	0.992	Adenosine deaminase
2	9606.ENSP00000367615	0.989	Adenine phosphoribosyltransferase
3	9606.ENSP00000354532	0.981	Purine nucleoside phosphorylase
4	9606.ENSP00000346921	0.980	Adenylate kinase 2, mitochondrial
5	9606.ENSP00000485525	0.979	Adenylosuccinate lyase
6	9606.ENSP00000362271	0.974	Adenylate kinase isoenzyme 1
7	9606.ENSP00000379802	0.972	AMP deaminase 3
8	9606.ENSP00000256578	0.970	AMP deaminase 2
9	9606.ENSP00000360250	0.969	Ectonucleoside triphosphate diphosphohydrolase 1
10	9606.ENSP00000257770	0.968	5'-nucleotidase
11	9606.ENSP00000217426	0.965	Adenosylhomocysteinase
12	9606.ENSP00000430075	0.964	AMP deaminase 1
13	9606.ENSP00000378743	0.958	Adenylate kinase 4, mitochondrial
14	9606.ENSP00000298545	0.957	Adenylate kinase 8
15	9606.ENSP00000410186	0.954	Adenylate kinase 9
16	9606.ENSP00000371230	0.953	GTP:AMP phosphotransferase AK3, mitochondrial
17	9606.ENSP00000382731	0.950	Adenosine deaminase 2
18	9606.ENSP00000267584	0.943	Adenylate kinase 7
19	9606.ENSP00000339479	0.942	Cytosolic purine 5'-nucleotidase
20	9606.ENSP00000360561	0.941	Ectonucleoside triphosphate diphosphohydrolase 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.998	binding
GO:0004001	0.998	adenosine kinase activity
GO:1901363	0.869	heterocyclic compound binding
GO:0097159	0.869	organic cyclic compound binding
GO:0005515	0.850	protein binding
GO:0043167	0.623	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901360	0.997	organic cyclic compound metabolic process
GO:0046483	0.997	heterocycle metabolic process
GO:0006725	0.997	cellular aromatic compound metabolic process
GO:0034641	0.997	cellular nitrogen compound metabolic process
GO:0055086	0.992	nucleobase-containing small molecule metabolic process
GO:0009123	0.959	nucleoside monophosphate metabolic process
GO:1901293	0.914	nucleoside phosphate biosynthetic process
GO:1901564	0.889	organonitrogen compound metabolic process
GO:0009161	0.814	ribonucleoside monophosphate metabolic process
GO:0009124	0.682	nucleoside monophosphate biosynthetic process
GO:1901135	0.678	carbohydrate derivative metabolic process
GO:0009156	0.649	ribonucleoside monophosphate biosynthetic process
GO:0072521	0.638	purine-containing compound metabolic process
GO:0009117	0.420	nucleotide metabolic process
GO:1901566	0.387	organonitrogen compound biosynthetic process
GO:0065007	0.354	biological regulation
GO:0006163	0.346	purine nucleotide metabolic process
GO:1901137	0.332	carbohydrate derivative biosynthetic process
GO:0072522	0.310	purine-containing compound biosynthetic process
GO:0050789	0.304	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0070013	0.997	intracellular organelle lumen
GO:0031981	0.992	nuclear lumen
GO:0005886	0.988	plasma membrane
GO:0005654	0.984	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:20824	0.998	adenosine + ATP = ADP + AMP + H(+)
EC:2.7.1.20	0.998	adenosine kinase.

[back to server]