StarFunc result for job id P55265

User Input

>input (1226 residues)
MNPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQ
TPSLPPSLPGLRPRFPVLLASSTRGRQVDIRGVPRGVHLRSQGLQRGFQHPSPRGRSLPQ
RGVDCLSSHFQELSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLA
KKGKLQKEAGTPPLWKIAVSTQAWNQHSGVVRPDGHSQGAPNSDPSLEPEDRNSTSVSED
LLEPFIAVSAQAWNQHSGVVRPDSHSQGSPNSDPGLEPEDSNSTSALEDPLEFLDMAEIK
EKICDYLFNVSDSSALNLAKNIGLTKARDINAVLIDMERQGDVYRQGTTPPIWHLTDKKR
ERMQIKRNTNSVPETAPAAIPETKRNAEFLTCNIPTSNASNNMVTTEKVENGQEPVIKLE
NRQEARPEPARLKPPVHYNGPSKAGYVDFENGQWATDDIPDDLNSIRAAPGEFRAIMEMP
SFYSHGLPRCSPYKKLTECQLKNPISGLLEYAQFASQTCEFNMIEQSGPPHEPRFKFQVV
INGREFPPAEAGSKKVAKQDAAMKAMTILLEEAKAKDSGKSEESSHYSTEKESEKTAESQ
TPTPSATSFFSGKSPVTTLLECMHKLGNSCEFRLLSKEGPAHEPKFQYCVAVGAQTFPSV
SAPSKKVAKQMAAEEAMKALHGEATNSMASDNQPEGMISESLDNLESMMPNKVRKIGELV
RYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQG
KQEAADAALRVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTF
HDQIAMLSHRCFNTLTNSFQPSLLGRKILAAIIMKKDSEDMGVVVSLGTGNRCVKGDSLS
LKGETVNDCHAEIISRRGFIRFLYSELMKYNSQTAKDSIFEPAKGGEKLQIKKTVSFHLY
ISTAPCGDGALFDKSCSDRAMESTESRHYPVFENPKQGKLRTKVENGEGTIPVESSDIVP
TWDGIRLGERLRTMSCSDKILRWNVLGLQGALLTHFLQPIYLKSVTLGYLFSQGHLTRAI
CCRVTRDGSAFEDGLRHPFIVNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYDLEILD
GTRGTVDGPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDYETAKNYFK
KGLKDMGYGNWISKPQEEKNFYLCPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55265	1.000	1.000	0.000	1226	1.000	1.000	P55265.pdb.gz	DSRAD_HUMAN Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR PE=1 SV=4
2	PDB:7zpkC	0.103	0.400	3.421E-13	233	0.047	0.249	7zpkC.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
3	PDB:8dfvK	0.068	0.280	3.980E-10	253	0.041	0.198	8dfvK.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
4	PDB:7v6cB	0.066	0.273	1.221E-7	260	0.032	0.150	7v6cB.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
5	PDB:8dgaK	0.061	0.358	5.203E-6	182	0.031	0.209	8dgaK.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
6	PDB:1yykA	0.056	0.299	3.034E-3	221	0.021	0.118	1yykA.pdb.gz	Intermediate states of ribonuclease III in complex with double-stranded RNA
7	PDB:7l08c	0.056	0.230	8.142E-3	289	0.012	0.052	7l08c.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
8	AFDB:P38800	0.050	0.047	8.830E-3	1345	0.101	0.092	P38800.pdb.gz	LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAM4 PE=1 SV=1
9	PDB:3j6b5	0.056	0.201	1.209E-2	326	0.015	0.055	3j6b5.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
10	AFDB:Q54I36	0.049	0.046	1.447E-2	1338	0.098	0.090	Q54I36.pdb.gz	PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum OX=44689 GN=pyk3 PE=1 SV=1
11	AFDB:Q90X22	0.050	0.049	1.597E-2	1276	0.082	0.079	Q90X22.pdb.gz
12	PDB:7r97A	0.055	0.288	1.980E-2	226	0.013	0.071	7r97A.pdb.gz	Structural basis for Dicer-like function of an engineered RNase III variant and insights into the reaction trajectory of two-Mg 2+ -ion catalysis.
13	AFDB:A0A1D8PE20	0.064	0.066	2.044E-2	1073	0.100	0.115	A0A1D8PE20.pdb.gz	A0A1D8PE20_CANAL VASt domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C107440WA PE=3 SV=1
14	PDB:5k1yD	0.058	0.612	3.952E-2	92	0.011	0.152	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
15	PDB:1r1uC	0.058	0.586	4.583E-2	98	0.013	0.163	1r1uC.pdb.gz
16	AFDB:Q9W3Q5	0.065	0.064	6.055E-2	1268	0.086	0.084	Q9W3Q5.pdb.gz	Q9W3Q5_DROME Checkpoint suppressor 1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=CHES-1-like PE=4 SV=4
17	AFDB:A6NAF9	0.048	0.054	8.987E-2	1079	0.042	0.048	A6NAF9.pdb.gz	TRD7A_DANRE Tudor domain-containing protein 7A OS=Danio rerio OX=7955 GN=tdrd7a PE=2 SV=2
18	AFDB:D3YXK1	0.057	0.119	3.580E-1	519	0.051	0.121	D3YXK1.pdb.gz	SAMD1_MOUSE Sterile alpha motif domain-containing protein 1 OS=Mus musculus OX=10090 GN=Samd1 PE=1 SV=1
19	AFDB:D3ZBP2	0.040	0.042	3.580E-1	1129	0.061	0.066	D3ZBP2.pdb.gz	D3ZBP2_RAT SIN3 transcription regulator family member A OS=Rattus norvegicus OX=10116 GN=Sin3a PE=1 SV=2
20	AFDB:Q86BS3	0.042	0.053	3.952E-1	926	0.086	0.114	Q86BS3.pdb.gz	Q86BS3_DROME Chromator, isoform A OS=Drosophila melanogaster OX=7227 GN=Chro PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3B3IRQ9	0.0	2380	1158	0.944	0.999	A0A3B3IRQ9_HUMAN Double-stranded RNA-specific adenosine deaminase (Fragment) OS=Homo sapiens OX=9606 GN=ADAR PE=1 SV=1
2	F1MUM9	0.0	1964	1149	0.794	0.847	F1MUM9_BOVIN Adenosine deaminase RNA specific OS=Bos taurus OX=9913 GN=ADAR PE=1 SV=3
3	P55265	0.0	2553	1226	1.000	1.000	DSRAD_HUMAN Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR PE=1 SV=4
4	P55266	0.0	1855	1175	0.757	0.790	DSRAD_RAT Double-stranded RNA-specific adenosine deaminase OS=Rattus norvegicus OX=10116 GN=Adar PE=1 SV=1
5	Q99MU3	0.0	1867	1178	0.762	0.793	DSRAD_MOUSE Double-stranded RNA-specific adenosine deaminase OS=Mus musculus OX=10090 GN=Adar PE=1 SV=2
6	Q91ZS8	1.90e-76	270	711	0.151	0.260	RED1_MOUSE Double-stranded RNA-specific editase 1 OS=Mus musculus OX=10090 GN=Adarb1 PE=1 SV=1
7	P51400	5.90e-76	268	711	0.149	0.257	RED1_RAT Double-stranded RNA-specific editase 1 OS=Rattus norvegicus OX=10116 GN=Adarb1 PE=1 SV=1
8	Q9NII1	2.70e-73	260	676	0.166	0.300	ADAR_DROME Double-stranded RNA-specific editase Adar OS=Drosophila melanogaster OX=7227 GN=Adar PE=1 SV=2
9	Q9NS39	1.12e-71	257	739	0.142	0.235	RED2_HUMAN Double-stranded RNA-specific editase B2 OS=Homo sapiens OX=9606 GN=ADARB2 PE=1 SV=1
10	P78563	1.53e-70	254	741	0.150	0.248	RED1_HUMAN Double-stranded RNA-specific editase 1 OS=Homo sapiens OX=9606 GN=ADARB1 PE=1 SV=1
11	Q22618	7.95e-54	198	495	0.104	0.257	DSRAD_CAEEL Double-stranded RNA-specific adenosine deaminase adr-2 OS=Caenorhabditis elegans OX=6239 GN=adr-2 PE=1 SV=2
12	Q5SUE7	1.08e-35	147	619	0.117	0.233	ADAD1_MOUSE Adenosine deaminase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Adad1 PE=1 SV=1
13	F4HU58	2.65e-34	139	420	0.100	0.293	TAD1_ARATH tRNA-specific adenosine deaminase TAD1 OS=Arabidopsis thaliana OX=3702 GN=TAD1 PE=1 SV=1
14	Q9V3R6	7.72e-30	125	394	0.095	0.297	ADAT1_DROME tRNA-specific adenosine deaminase 1 OS=Drosophila melanogaster OX=7227 GN=Adat1 PE=1 SV=1
15	Q9D5P4	9.77e-23	106	561	0.130	0.283	ADAD2_MOUSE Adenosine deaminase domain-containing protein 2 OS=Mus musculus OX=10090 GN=Adad2 PE=1 SV=2
16	Q9BUB4	2.16e-16	86.3	502	0.059	0.143	ADAT1_HUMAN tRNA-specific adenosine deaminase 1 OS=Homo sapiens OX=9606 GN=ADAT1 PE=1 SV=1
17	A9YT50	4.26e-16	85.9	682	0.069	0.123	A9YT50_DANRE Double-stranded RNA activated protein kinase OS=Danio rerio OX=7955 GN=pkr PE=2 SV=1
18	Q9U3D6	2.61e-15	84.0	964	0.091	0.116	ADR1_CAEEL A-to-I RNA editing regulator adr-1 OS=Caenorhabditis elegans OX=6239 GN=adr-1 PE=1 SV=2
19	O42912	3.81e-11	68.9	388	0.048	0.152	TAD1_SCHPO tRNA-specific adenosine deaminase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC16A3.06 PE=3 SV=1
20	Q389P9	2.79e-08	60.5	618	0.053	0.105	Q389P9_TRYB2 Adenosine deaminase-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0070 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02137 A_deamin	1.3e-97	338.8	Adenosine-deaminase (editase) domain
2	PF03368 Dicer_dimer	28	16.2	Dicer dimerisation domain
3	PF14709 DND1_DSRM	0.0082	27.7	double strand RNA binding domain from DEAD END PROTEIN 1
4	PF00035 dsrm	3.7e-31	119.0	Double-stranded RNA binding motif
5	PF01978 TrmB	0.058	24.6	Sugar-specific transcriptional regulator TrmB
6	PF02295 z-alpha	1.8e-54	192.9	Adenosine deaminase z-alpha domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357459

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000437256	0.992	Endoribonuclease Dicer
2	9606.ENSP00000385269	0.974	ELAV-like protein 1
3	9606.ENSP00000228928	0.972	2'-5'-oligoadenylate synthase 3
4	9606.ENSP00000262878	0.971	Deoxynucleoside triphosphate triphosphohydrolase SAMHD1
5	9606.ENSP00000342278	0.971	2'-5'-oligoadenylate synthase 2
6	9606.ENSP00000360869	0.968	Interferon-induced protein with tetratricopeptide repeats 1
7	9606.ENSP00000360883	0.966	Interferon-induced protein with tetratricopeptide repeats 3
8	9606.ENSP00000470142	0.966	Regulator of nonsense transcripts 1
9	9606.ENSP00000380697	0.962	Interferon regulatory factor 7
10	9606.ENSP00000315768	0.961	Signal transducer and activator of transcription 2
11	9606.ENSP00000356530	0.960	2-5A-dependent ribonuclease
12	9606.ENSP00000381601	0.960	Interferon-induced GTP-binding protein Mx1
13	9606.ENSP00000354394	0.959	Signal transducer and activator of transcription 1-alpha/beta
14	9606.ENSP00000368699	0.957	Ubiquitin-like protein ISG15
15	9606.ENSP00000371471	0.953	Radical S-adenosyl methionine domain-containing protein 2
16	9606.ENSP00000380073	0.953	Interferon regulatory factor 9
17	9606.ENSP00000388001	0.953	2'-5'-oligoadenylate synthase 1
18	9606.ENSP00000360860	0.952	Interferon-induced protein with tetratricopeptide repeats 5
19	9606.ENSP00000333657	0.946	Interferon-induced GTP-binding protein Mx2
20	9606.ENSP00000306565	0.944	Interferon-stimulated gene 20 kDa protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.999	RNA binding
GO:0004000	0.998	adenosine deaminase activity
GO:0003726	0.711	double-stranded RNA adenosine deaminase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.995	regulation of biological process
GO:0050896	0.989	response to stimulus
GO:0010605	0.988	negative regulation of macromolecule metabolic process
GO:0006396	0.988	RNA processing
GO:0050794	0.984	regulation of cellular process
GO:0034470	0.984	ncRNA processing
GO:0010629	0.979	negative regulation of gene expression
GO:0070918	0.973	regulatory ncRNA processing
GO:0009615	0.964	response to virus
GO:0051171	0.963	regulation of nitrogen compound metabolic process
GO:0048524	0.955	positive regulation of viral process
GO:0035196	0.955	miRNA processing
GO:0043086	0.954	negative regulation of catalytic activity
GO:0080090	0.951	regulation of primary metabolic process
GO:0045069	0.950	regulation of viral genome replication
GO:0048523	0.938	negative regulation of cellular process
GO:0031323	0.929	regulation of cellular metabolic process
GO:0051246	0.929	regulation of protein metabolic process
GO:0051172	0.928	negative regulation of nitrogen compound metabolic process
GO:0002376	0.923	immune system process
GO:0031324	0.921	negative regulation of cellular metabolic process
GO:0001933	0.905	negative regulation of protein phosphorylation
GO:0016553	0.898	base conversion or substitution editing
GO:0006950	0.897	response to stress
GO:0098542	0.878	defense response to other organism
GO:0042221	0.713	response to chemical
GO:0010033	0.654	response to organic substance
GO:0006955	0.496	immune response
GO:0048522	0.487	positive regulation of cellular process
GO:0043549	0.482	regulation of kinase activity
GO:0071840	0.465	cellular component organization or biogenesis
GO:0009893	0.462	positive regulation of metabolic process
GO:0010604	0.444	positive regulation of macromolecule metabolic process
GO:0051348	0.432	negative regulation of transferase activity
GO:0016043	0.429	cellular component organization
GO:0051716	0.428	cellular response to stimulus
GO:0048583	0.418	regulation of response to stimulus
GO:0034097	0.413	response to cytokine
GO:0051179	0.398	localization
GO:0009889	0.391	regulation of biosynthetic process
GO:0010556	0.382	regulation of macromolecule biosynthetic process
GO:0019219	0.377	regulation of nucleobase-containing compound metabolic process
GO:0033673	0.374	negative regulation of kinase activity
GO:0051252	0.368	regulation of RNA metabolic process
GO:0045087	0.351	innate immune response
GO:0006469	0.339	negative regulation of protein kinase activity
GO:0031326	0.331	regulation of cellular biosynthetic process
GO:0051641	0.320	cellular localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0005730	0.995	nucleolus
GO:0005737	0.969	cytoplasm
GO:0032991	0.955	protein-containing complex
GO:0016020	0.863	membrane
GO:0005829	0.835	cytosol
GO:0044530	0.387	supraspliceosomal complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24408	0.998	adenosine + H(+) + H2O = inosine + NH4(+)
EC:3.5.4.4	0.998	adenosine deaminase.

[back to server]