StarFunc result for job id P55268

User Input

>input (1798 residues)
MELTSRERGRGQPLPWELRLGLLLSVLAATLAQAPAPDVPGCSRGSCYPATGDLLVGRAD
RLTASSTCGLNGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRR
AAWWQSENGIPAVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSY
DCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQNLL
KITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASECAPAPGAPA
HAEGMVHGACICKHNTRGLNCEQCQDFYRDLPWRPAEDGHSHACRKCECHGHTHSCHFDM
AVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDG
GRCDSHDDPALGLVSGQCRCKEHVVGTRCQQCRDGFFGLSISDRLGCRRCQCNARGTVPG
STPCDPNSGSCYCKRLVTGRGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEGTGQ
CHCRQHMVGRRCEQVQPGYFRPFLDHLIWEAEDTRGQVLDVVERLVTPGETPSWTGSGFV
RLQEGQTLEFLVASVPKAMDYDLLLRLEPQVPEQWAELELIVQRPGPVPAHSLCGHLVPK
DDRIQGTLQPHARYLIFPNPVCLEPGISYKLHLKLVRTGGSAQPETPYSGPGLLIDSLVL
LPRVLVLEMFSGGDAAALERQATFERYQCHEEGLVPSKTSPSEACAPLLISLSTLIYNGA
LPCQCNPQGSLSSECNPHGGQCLCKPGVVGRRCDLCAPGYYGFGPTGCQACQCSHEGALS
SLCEKTSGQCLCRTGAFGLRCDRCQRGQWGFPSCRPCVCNGHADECNTHTGACLGCRDHT
GGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHQDEYSQQIVCHCRAGY
TGLRCEACAPGHFGDPSRPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHHTEGPHCA
HCKPGFHGQAARQSCHRCTCNLLGTNPQQCPSPDQCHCDPSSGQCPCLPNVQGPSCDRCA
PNFWNLTSGHGCQPCACHPSRARGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDPGLQC
HACDCDSRGIDTPQCHRFTGHCSCRPGVSGVRCDQCARGFSGIFPACHPCHACFGDWDRV
VQDLAARTQRLEQRAQELQQTGVLGAFESSFWHMQEKLGIVQGIVGARNTSAASTAQLVE
ATEELRREIGEATEHLTQLEADLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDL
LKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFN
SKHMANQRALGKLSAHTHTLSLTDINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGGL
SCNGAAATADLALGRARHTQAELQRALAEGGSILSRVAETRRQASEAQQRAQAALDKANA
SRGQVEQANQELQELIQSVKDFLNQEGADPDSIEMVATRVLELSIPASAEQIQHLAGAIA
ERVRSLADVDAILARTVGDVRRAEQLLQDARRARSWAEDEKQKAETVQAALEEAQRAQGI
AQGAIRGAVADTRDTEQTLYQVQERMAGAERALSSAGERARQLDALLEALKLKRAGNSLA
ASTAEETAGSAQGRAQEAEQLLRGPLGDQYQTVKALAERKAQGVLAAQARAEQLRDEARD
LLQAAQDKLQRLQELEGTYEENERALESKAAQLDGLEARMRSVLQAINLQVQIYNTCQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IDN1	0.300	0.302	0.000	1785	0.499	0.503	A0A0R4IDN1.pdb.gz
2	AFDB:B7ZDA6	0.235	0.237	0.000	1782	0.593	0.598	B7ZDA6.pdb.gz	B7ZDA6_DANRE Laminin subunit beta-2 precursor OS=Danio rerio OX=7955 GN=si:dkey-32e6.2 PE=1 SV=1
3	AFDB:D3ZQN7	0.229	0.230	0.000	1786	0.490	0.493	D3ZQN7.pdb.gz	D3ZQN7_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=3
4	AFDB:O44565	0.241	0.242	0.000	1790	0.398	0.400	O44565.pdb.gz	O44565_CAEEL Laminin subunit beta-1 OS=Caenorhabditis elegans OX=6239 GN=lam-1 PE=1 SV=3
5	AFDB:P11046	0.225	0.226	0.000	1788	0.394	0.396	P11046.pdb.gz	LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=LanB1 PE=1 SV=4
6	AFDB:P55268	1.000	1.000	0.000	1798	1.000	1.000	P55268.pdb.gz	LAMB2_HUMAN Laminin subunit beta-2 OS=Homo sapiens OX=9606 GN=LAMB2 PE=1 SV=2
7	AFDB:Q61292	0.226	0.226	0.000	1799	0.883	0.882	Q61292.pdb.gz	LAMB2_MOUSE Laminin subunit beta-2 OS=Mus musculus OX=10090 GN=Lamb2 PE=1 SV=2
8	AFDB:Q9Y6N6	0.208	0.235	6.336E-80	1575	0.245	0.280	Q9Y6N6.pdb.gz	LAMC3_HUMAN Laminin subunit gamma-3 OS=Homo sapiens OX=9606 GN=LAMC3 PE=1 SV=3
9	AFDB:Q9R0B6	0.210	0.236	2.348E-79	1581	0.244	0.277	Q9R0B6.pdb.gz	LAMC3_MOUSE Laminin subunit gamma-3 OS=Mus musculus OX=10090 GN=Lamc3 PE=1 SV=2
10	AFDB:Q1LVF0	0.188	0.211	1.812E-78	1593	0.226	0.255	Q1LVF0.pdb.gz	LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7955 GN=lamc1 PE=2 SV=2
11	PDB:7ufgA	0.048	0.070	2.528E-4	1151	0.057	0.089	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
12	PDB:8a3tA	0.060	0.419	8.890E-4	219	0.014	0.119	8a3tA.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
13	PDB:5es4B	0.042	0.084	1.582E-3	674	0.028	0.074	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
14	PDB:7qe7L	0.049	0.383	2.967E-3	183	0.008	0.082	7qe7L.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
15	PDB:2waaA	0.051	0.220	4.755E-3	335	0.009	0.051	2waaA.pdb.gz
16	PDB:4g1eB	0.044	0.087	5.863E-3	709	0.032	0.080	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
17	PDB:7ufgB	0.053	0.073	6.861E-3	1182	0.052	0.079	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
18	PDB:4bxsV	0.069	0.096	9.901E-3	1262	0.017	0.024	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
19	PDB:7q3nU	0.040	0.141	1.221E-2	292	0.022	0.137	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
20	PDB:7l2zF	0.047	0.105	1.356E-2	664	0.036	0.096	7l2zF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZQ25	0.0	1883	1834	0.499	0.489	A0A8I5ZQ25_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
2	A0A8I5ZVQ5	0.0	1806	1741	0.477	0.492	A0A8I5ZVQ5_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
3	A0A8I6A3T2	0.0	1883	1792	0.499	0.501	A0A8I6A3T2_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
4	B7ZDA6	0.0	2259	1782	0.594	0.599	B7ZDA6_DANRE Laminin subunit beta-2 precursor OS=Danio rerio OX=7955 GN=si:dkey-32e6.2 PE=1 SV=1
5	D3ZQN7	0.0	1882	1786	0.499	0.502	D3ZQN7_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=3
6	F1MNT4	0.0	1902	1786	0.502	0.506	F1MNT4_BOVIN Laminin subunit beta 1 OS=Bos taurus OX=9913 GN=LAMB1 PE=4 SV=3
7	O44565	0.0	1305	1790	0.398	0.399	O44565_CAEEL Laminin subunit beta-1 OS=Caenorhabditis elegans OX=6239 GN=lam-1 PE=1 SV=3
8	P02469	0.0	1884	1786	0.498	0.501	LAMB1_MOUSE Laminin subunit beta-1 OS=Mus musculus OX=10090 GN=Lamb1 PE=1 SV=3
9	P07942	0.0	1899	1786	0.500	0.503	LAMB1_HUMAN Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2
10	P11046	0.0	1302	1788	0.399	0.402	LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=LanB1 PE=1 SV=4
11	P55268	0.0	3668	1798	1.000	1.000	LAMB2_HUMAN Laminin subunit beta-2 OS=Homo sapiens OX=9606 GN=LAMB2 PE=1 SV=2
12	Q61292	0.0	3207	1799	0.884	0.883	LAMB2_MOUSE Laminin subunit beta-2 OS=Mus musculus OX=10090 GN=Lamb2 PE=1 SV=2
13	Q8JHV7	0.0	1843	1785	0.498	0.502	Q8JHV7_DANRE Laminin beta 1 OS=Danio rerio OX=7955 GN=lamb1 PE=1 SV=1
14	Q01635	1.52e-162	499	303	0.124	0.736	LAMB1_CHICK Laminin subunit beta-1 (Fragment) OS=Gallus gallus OX=9031 GN=LAMB1 PE=1 SV=1
15	Q13751	1.90e-130	441	1172	0.128	0.197	LAMB3_HUMAN Laminin subunit beta-3 OS=Homo sapiens OX=9606 GN=LAMB3 PE=1 SV=1
16	F1LPI5	9.73e-127	430	1172	0.126	0.194	F1LPI5_RAT Laminin subunit beta 3 OS=Rattus norvegicus OX=10116 GN=Lamb3 PE=4 SV=2
17	Q61087	3.76e-126	429	1168	0.125	0.192	LAMB3_MOUSE Laminin subunit beta-3 OS=Mus musculus OX=10090 GN=Lamb3 PE=1 SV=2
18	P15215	3.43e-101	362	1639	0.167	0.184	LAMC1_DROME Laminin subunit gamma-1 OS=Drosophila melanogaster OX=7227 GN=LanB2 PE=2 SV=2
19	F1MMT2	2.40e-99	358	1964	0.200	0.183	F1MMT2_BOVIN Laminin subunit alpha 2 OS=Bos taurus OX=9913 GN=LAMA2 PE=4 SV=3
20	Q1LVF0	6.85e-99	355	1593	0.176	0.198	LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7955 GN=lamc1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00754 F5_F8_type_C	42	15.7	F5/8 type C domain
2	PF00053 Laminin_EGF	5.9e-111	373.8	Laminin EGF domain
3	PF00055 Laminin_N	6.2e-74	260.0	Laminin N-terminal (Domain VI)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000388325

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258341	0.990	Laminin subunit gamma-1
2	9606.ENSP00000354360	0.987	Laminin subunit gamma-3
3	9606.ENSP00000252999	0.983	Laminin subunit alpha-5
4	9606.ENSP00000324532	0.980	Laminin subunit alpha-3
5	9606.ENSP00000230538	0.945	Laminin subunit alpha-4
6	9606.ENSP00000200181	0.943	Integrin beta-4
7	9606.ENSP00000374309	0.942	Laminin subunit alpha-1
8	9606.ENSP00000400365	0.942	Laminin subunit alpha-2
9	9606.ENSP00000379350	0.938	Integrin beta-1
10	9606.ENSP00000386896	0.938	Integrin alpha-6
11	9606.ENSP00000007722	0.934	Integrin alpha-3
12	9606.ENSP00000264144	0.933	Laminin subunit gamma-2
13	9606.ENSP00000452120	0.931	Integrin alpha-7
14	9606.ENSP00000442600	0.930	Dystroglycan
15	9606.ENSP00000298854	0.926	43 kDa receptor-associated protein of the synapse
16	9606.ENSP00000368678	0.926	Agrin
17	9606.ENSP00000222399	0.918	Laminin subunit beta-1
18	9606.ENSP00000346067	0.918	40S ribosomal protein SA
19	9606.ENSP00000356515	0.918	Utrophin
20	9606.ENSP00000354923	0.916	Dystrophin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.594	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0048856	0.991	anatomical structure development
GO:0032501	0.990	multicellular organismal process
GO:0007275	0.977	multicellular organism development
GO:0071840	0.967	cellular component organization or biogenesis
GO:0050896	0.962	response to stimulus
GO:0016043	0.944	cellular component organization
GO:0065007	0.917	biological regulation
GO:0030154	0.907	cell differentiation
GO:0050789	0.905	regulation of biological process
GO:0009653	0.890	anatomical structure morphogenesis
GO:0009888	0.881	tissue development
GO:0048513	0.879	animal organ development
GO:0050794	0.856	regulation of cellular process
GO:0048731	0.767	system development
GO:0051716	0.762	cellular response to stimulus
GO:0034330	0.724	cell junction organization
GO:0048468	0.698	cell development
GO:0006950	0.599	response to stress
GO:0031099	0.569	regeneration
GO:0009611	0.546	response to wounding
GO:0050953	0.546	sensory perception of light stimulus
GO:0120036	0.530	plasma membrane bounded cell projection organization
GO:0007399	0.530	nervous system development
GO:0040007	0.526	growth
GO:0007601	0.501	visual perception
GO:0010001	0.498	glial cell differentiation
GO:0060429	0.488	epithelium development
GO:0031175	0.466	neuron projection development
GO:0007409	0.452	axonogenesis
GO:0048589	0.437	developmental growth
GO:0001822	0.418	kidney development
GO:0072009	0.410	nephron epithelium development
GO:0048880	0.401	sensory system development
GO:0072311	0.384	glomerular epithelial cell differentiation
GO:0061318	0.366	renal filtration cell differentiation
GO:0001654	0.360	eye development
GO:0072310	0.357	glomerular epithelial cell development
GO:0021782	0.340	glial cell development
GO:0007417	0.339	central nervous system development
GO:0072112	0.339	podocyte differentiation
GO:0007155	0.337	cell adhesion
GO:0048518	0.333	positive regulation of biological process
GO:0016049	0.312	cell growth
GO:0060560	0.309	developmental growth involved in morphogenesis
GO:0033554	0.306	cellular response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005576	0.999	extracellular region
GO:0005604	0.997	basement membrane
GO:0043227	0.956	membrane-bounded organelle
GO:0005622	0.953	intracellular anatomical structure
GO:0043256	0.952	laminin complex
GO:0005886	0.946	plasma membrane
GO:0043229	0.912	intracellular organelle
GO:0005737	0.895	cytoplasm
GO:0043231	0.860	intracellular membrane-bounded organelle
GO:0030054	0.796	cell junction
GO:0043233	0.727	organelle lumen
GO:0005615	0.712	extracellular space
GO:0070013	0.695	intracellular organelle lumen
GO:0012505	0.689	endomembrane system
GO:0031982	0.666	vesicle
GO:0043230	0.623	extracellular organelle
GO:0065010	0.593	extracellular membrane-bounded organelle
GO:0070062	0.499	extracellular exosome
GO:0005783	0.449	endoplasmic reticulum
GO:0043260	0.389	laminin-11 complex
GO:0005608	0.384	laminin-3 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]