StarFunc result for job id P55273

User Input

>input (166 residues)
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALEL
LKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHT
AVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R796	0.998	0.998	1.250E-25	166	1.000	1.000	A0A024R796.pdb.gz
2	AFDB:Q60773	0.986	0.986	2.009E-23	166	0.867	0.867	Q60773.pdb.gz	CDN2D_MOUSE Cyclin-dependent kinase 4 inhibitor D OS=Mus musculus OX=10090 GN=Cdkn2d PE=1 SV=2
3	PDB:1bd8A	0.934	0.994	4.298E-22	156	0.940	1.000	1bd8A.pdb.gz
4	PDB:1ap7A	0.888	0.878	1.969E-16	168	0.867	0.857	1ap7A.pdb.gz
5	AFDB:P42773	0.886	0.876	3.170E-13	168	0.428	0.423	P42773.pdb.gz	CDN2C_HUMAN Cyclin-dependent kinase 4 inhibitor C OS=Homo sapiens OX=9606 GN=CDKN2C PE=1 SV=1
6	PDB:1bu9A	0.838	0.829	5.860E-11	168	0.434	0.429	1bu9A.pdb.gz
7	AFDB:P42772	0.700	0.840	4.403E-10	138	0.361	0.435	P42772.pdb.gz	CDN2B_HUMAN Cyclin-dependent kinase 4 inhibitor B OS=Homo sapiens OX=9606 GN=CDKN2B PE=1 SV=1
8	AFDB:P55271	0.719	0.914	1.148E-9	130	0.367	0.469	P55271.pdb.gz	CDN2B_MOUSE Cyclin-dependent kinase 4 inhibitor B OS=Mus musculus OX=10090 GN=Cdkn2b PE=1 SV=1
9	AFDB:Q9R0Z3	0.698	0.729	2.721E-9	159	0.355	0.371	Q9R0Z3.pdb.gz	CDN2A_RAT Cyclin-dependent kinase inhibitor 2A OS=Rattus norvegicus OX=10116 GN=Cdkn2a PE=2 SV=1
10	AFDB:P42771	0.715	0.760	3.992E-9	156	0.367	0.391	P42771.pdb.gz	CDN2A_HUMAN Cyclin-dependent kinase inhibitor 2A OS=Homo sapiens OX=9606 GN=CDKN2A PE=1 SV=2
11	AFDB:Q9P0K7	0.848	0.151	5.583E-9	980	0.283	0.048	Q9P0K7.pdb.gz	RAI14_HUMAN Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14 PE=1 SV=2
12	AFDB:P51480	0.699	0.691	7.094E-9	168	0.361	0.357	P51480.pdb.gz	CDN2A_MOUSE Cyclin-dependent kinase inhibitor 2A OS=Mus musculus OX=10090 GN=Cdkn2a PE=1 SV=2
13	AFDB:Q9EP71	0.583	0.136	1.388E-8	979	0.307	0.052	Q9EP71.pdb.gz	RAI14_MOUSE Ankycorbin OS=Mus musculus OX=10090 GN=Rai14 PE=1 SV=1
14	PDB:8cs9A	0.852	0.189	8.538E-8	796	0.271	0.057	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
15	PDB:2dvwA	0.786	0.581	1.928E-7	229	0.265	0.192	2dvwA.pdb.gz
16	PDB:1a5eA	0.660	0.700	2.023E-7	156	0.367	0.391	1a5eA.pdb.gz
17	PDB:1d9sA	0.662	0.799	3.957E-7	136	0.380	0.463	1d9sA.pdb.gz
18	PDB:6jd6B	0.803	0.702	6.091E-7	192	0.289	0.250	6jd6B.pdb.gz
19	PDB:4oauC	0.759	0.202	1.834E-6	692	0.265	0.064	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
20	PDB:6mwqA	0.777	0.275	5.263E-6	493	0.343	0.116	6mwqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P55273	7.58e-116	327	166	1.000	1.000	CDN2D_HUMAN Cyclin-dependent kinase 4 inhibitor D OS=Homo sapiens OX=9606 GN=CDKN2D PE=1 SV=1
2	Q60773	8.82e-101	288	166	0.867	0.867	CDN2D_MOUSE Cyclin-dependent kinase 4 inhibitor D OS=Mus musculus OX=10090 GN=Cdkn2d PE=1 SV=2
3	P42773	9.51e-35	121	168	0.410	0.405	CDN2C_HUMAN Cyclin-dependent kinase 4 inhibitor C OS=Homo sapiens OX=9606 GN=CDKN2C PE=1 SV=1
4	Q8R5G4	2.97e-34	120	168	0.398	0.393	Q8R5G4_RAT Cyclin-dependent kinase inhibitor 2C OS=Rattus norvegicus OX=10116 GN=Cdkn2c PE=1 SV=1
5	Q60772	3.14e-34	120	168	0.398	0.393	CDN2C_MOUSE Cyclin-dependent kinase 4 inhibitor C OS=Mus musculus OX=10090 GN=Cdkn2c PE=1 SV=1
6	P55271	1.38e-28	104	130	0.367	0.469	CDN2B_MOUSE Cyclin-dependent kinase 4 inhibitor B OS=Mus musculus OX=10090 GN=Cdkn2b PE=1 SV=1
7	P55272	1.91e-28	104	130	0.361	0.462	CDN2B_RAT Cyclin-dependent kinase 4 inhibitor B OS=Rattus norvegicus OX=10116 GN=Cdkn2b PE=2 SV=1
8	P42772	6.49e-28	103	138	0.361	0.435	CDN2B_HUMAN Cyclin-dependent kinase 4 inhibitor B OS=Homo sapiens OX=9606 GN=CDKN2B PE=1 SV=1
9	P42771	1.78e-26	99.8	156	0.367	0.391	CDN2A_HUMAN Cyclin-dependent kinase inhibitor 2A OS=Homo sapiens OX=9606 GN=CDKN2A PE=1 SV=2
10	P51480	1.11e-23	93.2	168	0.325	0.321	CDN2A_MOUSE Cyclin-dependent kinase inhibitor 2A OS=Mus musculus OX=10090 GN=Cdkn2a PE=1 SV=2
11	Q9R0Z3	1.99e-23	92.0	159	0.325	0.340	CDN2A_RAT Cyclin-dependent kinase inhibitor 2A OS=Rattus norvegicus OX=10116 GN=Cdkn2a PE=2 SV=1
12	Q12955	2.55e-19	86.3	4377	0.325	0.012	ANK3_HUMAN Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3
13	G5E8K5	3.65e-18	82.8	1961	0.325	0.028	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
14	O70511	4.40e-18	82.8	2622	0.325	0.021	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
15	O88521	1.34e-17	81.3	1762	0.319	0.030	O88521_RAT 190 kDa ankyrin isoform OS=Rattus norvegicus OX=10116 PE=2 SV=1
16	A0A5F9ZGS7	2.97e-17	80.1	1827	0.313	0.028	A0A5F9ZGS7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	A0A5F9ZHL5	3.18e-17	80.1	1872	0.313	0.028	A0A5F9ZHL5_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	A0A5F9ZH58	3.20e-17	80.1	1770	0.313	0.029	A0A5F9ZH58_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	A0A5F9ZHY6	3.20e-17	80.1	1763	0.313	0.029	A0A5F9ZHY6_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A5F9ZHQ5	3.28e-17	80.1	1894	0.313	0.027	A0A5F9ZHQ5_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	5e-07	41.1	Ankyrin repeat
2	PF12796 Ank_2	3.4e-16	70.9	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	8.5e-05	33.5	Ankyrin repeat
4	PF13637 Ank_4	2.4e-14	64.8	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.5e-16	71.5	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377224

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257904	0.999	Cyclin-dependent kinase 4
2	9606.ENSP00000265734	0.999	Cyclin-dependent kinase 6
3	9606.ENSP00000227507	0.955	G1/S-specific cyclin-D1
4	9606.ENSP00000362082	0.952	G1/S-specific cyclin-D3
5	9606.ENSP00000261254	0.949	G1/S-specific cyclin-D2
6	9606.ENSP00000228872	0.933	Cyclin-dependent kinase inhibitor 1B
7	9606.ENSP00000372023	0.932	Serine/threonine-protein kinase Chk2
8	9606.ENSP00000278616	0.929	Serine-protein kinase ATM
9	9606.ENSP00000258149	0.925	E3 ubiquitin-protein ligase Mdm2
10	9606.ENSP00000313420	0.922	DNA-dependent protein kinase catalytic subunit
11	9606.ENSP00000413720	0.916	Cyclin-dependent kinase inhibitor 1C
12	9606.ENSP00000343741	0.914	Serine/threonine-protein kinase ATR
13	9606.ENSP00000384849	0.896	Cyclin-dependent kinase inhibitor 1
14	9606.ENSP00000266970	0.795	Cyclin-dependent kinase 2
15	9606.ENSP00000274026	0.739	Cyclin-A2
16	9606.ENSP00000262643	0.728	G1/S-specific cyclin-E1
17	9606.ENSP00000418915	0.691	Cyclin-dependent kinase inhibitor 2A
18	9606.ENSP00000479860	0.691	Calcium and integrin binding 1
19	9606.ENSP00000313950	0.688	Aurora kinase B
20	9606.ENSP00000378699	0.688	Cyclin-dependent kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding
GO:0016538	0.998	cyclin-dependent protein serine/threonine kinase regulator activity
GO:0030291	0.840	protein serine/threonine kinase inhibitor activity
GO:0004861	0.763	cyclin-dependent protein serine/threonine kinase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0048523	0.978	negative regulation of cellular process
GO:0051726	0.976	regulation of cell cycle
GO:0009987	0.974	cellular process
GO:1901987	0.969	regulation of cell cycle phase transition
GO:0019222	0.959	regulation of metabolic process
GO:0060255	0.948	regulation of macromolecule metabolic process
GO:0080090	0.944	regulation of primary metabolic process
GO:0051171	0.944	regulation of nitrogen compound metabolic process
GO:0031323	0.944	regulation of cellular metabolic process
GO:1902806	0.936	regulation of cell cycle G1/S phase transition
GO:0071704	0.905	organic substance metabolic process
GO:0044238	0.905	primary metabolic process
GO:0045859	0.895	regulation of protein kinase activity
GO:0044237	0.867	cellular metabolic process
GO:0006807	0.857	nitrogen compound metabolic process
GO:0048518	0.857	positive regulation of biological process
GO:1901990	0.855	regulation of mitotic cell cycle phase transition
GO:0045786	0.838	negative regulation of cell cycle
GO:0050896	0.827	response to stimulus
GO:0044092	0.825	negative regulation of molecular function
GO:0071900	0.824	regulation of protein serine/threonine kinase activity
GO:1904029	0.818	regulation of cyclin-dependent protein kinase activity
GO:0010948	0.806	negative regulation of cell cycle process
GO:0043086	0.797	negative regulation of catalytic activity
GO:0048522	0.796	positive regulation of cellular process
GO:0000079	0.790	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0043170	0.787	macromolecule metabolic process
GO:2000045	0.785	regulation of G1/S transition of mitotic cell cycle
GO:2001020	0.775	regulation of response to DNA damage stimulus
GO:2001233	0.764	regulation of apoptotic signaling pathway
GO:2001242	0.737	regulation of intrinsic apoptotic signaling pathway
GO:0010605	0.656	negative regulation of macromolecule metabolic process
GO:0051172	0.646	negative regulation of nitrogen compound metabolic process
GO:0031324	0.594	negative regulation of cellular metabolic process
GO:1902229	0.577	regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:0051716	0.554	cellular response to stimulus
GO:1901988	0.531	negative regulation of cell cycle phase transition
GO:0010468	0.527	regulation of gene expression
GO:0006950	0.493	response to stress
GO:0042127	0.493	regulation of cell population proliferation
GO:0019219	0.483	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.470	regulation of cellular biosynthetic process
GO:0010556	0.469	regulation of macromolecule biosynthetic process
GO:0090304	0.418	nucleic acid metabolic process
GO:0051128	0.404	regulation of cellular component organization
GO:0009893	0.385	positive regulation of metabolic process
GO:0033554	0.367	cellular response to stress
GO:0051248	0.352	negative regulation of protein metabolic process
GO:0007154	0.350	cell communication
GO:0051252	0.346	regulation of RNA metabolic process
GO:1903506	0.335	regulation of nucleic acid-templated transcription
GO:0006355	0.334	regulation of DNA-templated transcription
GO:0032501	0.307	multicellular organismal process
GO:1902807	0.304	negative regulation of cell cycle G1/S phase transition

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005829	0.997	cytosol
GO:0032991	0.856	protein-containing complex
GO:1990234	0.697	transferase complex
GO:1902554	0.615	serine/threonine protein kinase complex
GO:0000307	0.608	cyclin-dependent protein kinase holoenzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]