StarFunc result for job id P55317

User Input

>input (472 residues)
MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMT
PASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQ
AASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLIT
MAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGK
GSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGA
SNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPI
SSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAY
EQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55317	0.999	0.999	7.861E-71	472	1.000	1.000	P55317.pdb.gz	FOXA1_HUMAN Hepatocyte nuclear factor 3-alpha OS=Homo sapiens OX=9606 GN=FOXA1 PE=1 SV=2
2	AFDB:B0ZTD4	0.229	0.233	1.750E-35	463	0.570	0.581	B0ZTD4.pdb.gz	B0ZTD4_HUMAN Forkhead box A2 OS=Homo sapiens OX=9606 GN=FOXA2 PE=4 SV=1
3	AFDB:Q9QY14	0.225	0.365	2.455E-17	288	0.208	0.340	Q9QY14.pdb.gz	FOXE3_MOUSE Forkhead box protein E3 OS=Mus musculus OX=10090 GN=Foxe3 PE=1 SV=1
4	AFDB:Q13461	0.224	0.329	3.845E-17	319	0.222	0.329	Q13461.pdb.gz	FOXE3_HUMAN Forkhead box protein E3 OS=Homo sapiens OX=9606 GN=FOXE3 PE=1 SV=2
5	AFDB:Q61574	0.233	0.327	6.845E-17	329	0.229	0.328	Q61574.pdb.gz	FOXS1_MOUSE Forkhead box protein S1 OS=Mus musculus OX=10090 GN=Foxs1 PE=2 SV=2
6	AFDB:Q12952	0.211	0.285	8.296E-17	345	0.258	0.354	Q12952.pdb.gz	FOXL1_HUMAN Forkhead box protein L1 OS=Homo sapiens OX=9606 GN=FOXL1 PE=2 SV=2
7	AFDB:P34683	0.230	0.450	2.035E-16	237	0.201	0.401	P34683.pdb.gz	LIN31_CAEEL Protein lin-31 OS=Caenorhabditis elegans OX=6239 GN=lin-31 PE=4 SV=1
8	AFDB:Q9PSY4	0.228	0.310	1.082E-14	345	0.218	0.299	Q9PSY4.pdb.gz	FOXD1_XENLA Forkhead box protein D1 OS=Xenopus laevis OX=8355 GN=foxd1 PE=2 SV=2
9	AFDB:A0A0R4IJS9	0.196	0.291	4.451E-13	312	0.199	0.301	A0A0R4IJS9.pdb.gz	A0A0R4IJS9_DANRE Forkhead box Q1a OS=Danio rerio OX=7955 GN=foxq1l PE=4 SV=1
10	AFDB:O14270	0.210	0.147	1.175E-10	743	0.197	0.125	O14270.pdb.gz	FHL1_SCHPO Fork head transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fhl1 PE=3 SV=2
11	PDB:2hdcA	0.176	0.685	1.498E-9	97	0.133	0.649	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:7k5yU	0.136	0.663	3.557E-2	75	0.028	0.173	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
13	PDB:2qbyB	0.124	0.154	8.725E-2	368	0.028	0.035	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
14	PDB:3euhB	0.151	0.213	9.302E-2	321	0.017	0.025	3euhB.pdb.gz
15	PDB:5k1yD	0.116	0.478	1.366E-1	92	0.028	0.141	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
16	PDB:6i6mB	0.126	0.160	1.553E-1	357	0.032	0.042	6i6mB.pdb.gz	Structure of Papaver somniferum O-Methyltransferase 1 Reveals Initiation of Noscapine Biosynthesis with Implications for Plant Natural Product Methylation
17	PDB:4etsB	0.124	0.349	1.883E-1	149	0.015	0.047	4etsB.pdb.gz	Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
18	PDB:6zmiCE	0.120	0.673	1.883E-1	72	0.028	0.181	6zmiCE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
19	PDB:2fxaB	0.116	0.270	2.007E-1	180	0.025	0.067	2fxaB.pdb.gz
20	PDB:1fp1D	0.120	0.160	2.594E-1	340	0.030	0.041	1fp1D.pdb.gz	Structures of two natural product methyltransferases reveal the basis for substrate specificity in plant O-methyltransferases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P23512	0.0	763	466	0.915	0.927	FOXA1_RAT Hepatocyte nuclear factor 3-alpha OS=Rattus norvegicus OX=10116 GN=Foxa1 PE=1 SV=1
2	P35582	0.0	799	468	0.947	0.955	FOXA1_MOUSE Hepatocyte nuclear factor 3-alpha OS=Mus musculus OX=10090 GN=Foxa1 PE=1 SV=2
3	P55317	0.0	956	472	1.000	1.000	FOXA1_HUMAN Hepatocyte nuclear factor 3-alpha OS=Homo sapiens OX=9606 GN=FOXA1 PE=1 SV=2
4	Q6P0C9	5.32e-180	512	427	0.636	0.703	Q6P0C9_DANRE Forkhead box A1 OS=Danio rerio OX=7955 GN=fkd7 PE=2 SV=1
5	Q91765	8.99e-147	428	434	0.547	0.594	FXA2A_XENLA Forkhead box protein A2-A OS=Xenopus laevis OX=8355 GN=foxa2-a PE=1 SV=1
6	Q07342	1.78e-135	398	409	0.536	0.619	FOXA2_DANRE Forkhead box protein A2 OS=Danio rerio OX=7955 GN=foxa2 PE=2 SV=1
7	P35583	5.95e-132	391	459	0.557	0.573	FOXA2_MOUSE Hepatocyte nuclear factor 3-beta OS=Mus musculus OX=10090 GN=Foxa2 PE=1 SV=2
8	B0ZTD4	9.86e-126	375	463	0.540	0.551	B0ZTD4_HUMAN Forkhead box A2 OS=Homo sapiens OX=9606 GN=FOXA2 PE=4 SV=1
9	Q9Y261	1.14e-125	375	457	0.540	0.558	FOXA2_HUMAN Hepatocyte nuclear factor 3-beta OS=Homo sapiens OX=9606 GN=FOXA2 PE=1 SV=1
10	P32182	3.28e-122	366	458	0.551	0.568	FOXA2_RAT Hepatocyte nuclear factor 3-beta OS=Rattus norvegicus OX=10116 GN=Foxa2 PE=1 SV=1
11	O73778	7.46e-106	323	441	0.449	0.481	O73778_DANRE Fork head domain protein FKD2 OS=Danio rerio OX=7955 GN=fkd2 PE=2 SV=1
12	O73843	2.29e-87	272	324	0.371	0.540	O73843_SALSA Fork head domain protein OS=Salmo salar OX=8030 GN=fkh PE=2 SV=1
13	P33205	1.13e-83	265	399	0.400	0.474	FXA4A_XENLA Forkhead box protein A4-A OS=Xenopus laevis OX=8355 GN=foxa4-a PE=1 SV=3
14	P14734	7.28e-71	235	510	0.335	0.310	FKH_DROME Protein fork head OS=Drosophila melanogaster OX=7227 GN=fkh PE=1 SV=1
15	P55318	2.11e-70	229	350	0.218	0.294	FOXA3_HUMAN Hepatocyte nuclear factor 3-gamma OS=Homo sapiens OX=9606 GN=FOXA3 PE=1 SV=2
16	P35584	5.52e-70	228	353	0.218	0.292	FOXA3_MOUSE Hepatocyte nuclear factor 3-gamma OS=Mus musculus OX=10090 GN=Foxa3 PE=1 SV=1
17	P32183	1.03e-69	228	354	0.216	0.288	FOXA3_RAT Hepatocyte nuclear factor 3-gamma OS=Rattus norvegicus OX=10116 GN=Foxa3 PE=1 SV=1
18	Q17381	1.31e-60	208	506	0.189	0.176	PHA4_CAEEL Defective pharyngeal development protein 4 OS=Caenorhabditis elegans OX=6239 GN=pha-4 PE=1 SV=1
19	Q64732	1.48e-51	179	325	0.157	0.228	FOXB1_MOUSE Forkhead box protein B1 OS=Mus musculus OX=10090 GN=Foxb1 PE=2 SV=2
20	Q99853	1.48e-51	179	325	0.157	0.228	FOXB1_HUMAN Forkhead box protein B1 OS=Homo sapiens OX=9606 GN=FOXB1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	8.3e-35	130.1	Forkhead domain
2	PF08430 Forkhead_N	1e-25	102.4	Forkhead N-terminal region
3	PF09354 HNF_C	7.5e-26	102.2	HNF3 C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000250448

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363822	0.999	Androgen receptor
2	9606.ENSP00000405330	0.998	Estrogen receptor
3	9606.ENSP00000368632	0.985	Trans-acting T-cell-specific transcription factor GATA-3
4	9606.ENSP00000452871	0.975	Transducin-like enhancer protein 3
5	9606.ENSP00000291527	0.974	Trefoil factor 1
6	9606.ENSP00000346879	0.966	Homeobox protein Nkx-2.1
7	9606.ENSP00000227507	0.948	G1/S-specific cyclin-D1
8	9606.ENSP00000430690	0.944	Trefoil factor 3
9	9606.ENSP00000263253	0.907	Histone acetyltransferase p300
10	9606.ENSP00000362748	0.897	Methylcytosine dioxygenase TET1
11	9606.ENSP00000361066	0.876	Nuclear receptor coactivator 3
12	9606.ENSP00000383063	0.872	Nuclear receptor-interacting protein 1
13	9606.ENSP00000312987	0.865	Hepatocyte nuclear factor 4-alpha
14	9606.ENSP00000325120	0.845	Progesterone receptor
15	9606.ENSP00000383042	0.845	Lysine-specific histone demethylase 1A
16	9606.ENSP00000408617	0.841	Histone deacetylase 9
17	9606.ENSP00000262189	0.831	Histone-lysine N-methyltransferase 2C
18	9606.ENSP00000296417	0.809	Histone H2A.Z
19	9606.ENSP00000391490	0.801	Anterior gradient protein 2 homolog
20	9606.ENSP00000375942	0.786	TATA-box-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0005515	0.999	protein binding
GO:0001216	0.999	DNA-binding transcription activator activity
GO:0001228	0.991	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.996	regulation of gene expression
GO:0080090	0.995	regulation of primary metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0006355	0.993	regulation of DNA-templated transcription
GO:0010604	0.980	positive regulation of macromolecule metabolic process
GO:0051173	0.979	positive regulation of nitrogen compound metabolic process
GO:0031325	0.979	positive regulation of cellular metabolic process
GO:0006357	0.972	regulation of transcription by RNA polymerase II
GO:0009987	0.970	cellular process
GO:0045893	0.965	positive regulation of DNA-templated transcription
GO:0032502	0.962	developmental process
GO:0048856	0.944	anatomical structure development
GO:0048519	0.941	negative regulation of biological process
GO:0048523	0.934	negative regulation of cellular process
GO:0032501	0.916	multicellular organismal process
GO:0045944	0.907	positive regulation of transcription by RNA polymerase II
GO:0050896	0.875	response to stimulus
GO:0007275	0.859	multicellular organism development
GO:0048731	0.804	system development
GO:0048583	0.653	regulation of response to stimulus
GO:0023051	0.600	regulation of signaling
GO:0010646	0.600	regulation of cell communication
GO:0009892	0.492	negative regulation of metabolic process
GO:0009966	0.491	regulation of signal transduction
GO:0010605	0.476	negative regulation of macromolecule metabolic process
GO:0051172	0.470	negative regulation of nitrogen compound metabolic process
GO:0031324	0.464	negative regulation of cellular metabolic process
GO:0042221	0.454	response to chemical
GO:0051716	0.448	cellular response to stimulus
GO:0051253	0.448	negative regulation of RNA metabolic process
GO:0010558	0.447	negative regulation of macromolecule biosynthetic process
GO:0031327	0.447	negative regulation of cellular biosynthetic process
GO:0009653	0.435	anatomical structure morphogenesis
GO:0007154	0.433	cell communication
GO:0009888	0.425	tissue development
GO:0010941	0.414	regulation of cell death
GO:0051239	0.406	regulation of multicellular organismal process
GO:0045892	0.401	negative regulation of DNA-templated transcription
GO:0043067	0.396	regulation of programmed cell death
GO:0065009	0.388	regulation of molecular function
GO:0023052	0.377	signaling
GO:0007165	0.364	signal transduction
GO:0048869	0.358	cellular developmental process
GO:0007399	0.350	nervous system development
GO:0030154	0.348	cell differentiation
GO:0050793	0.338	regulation of developmental process
GO:0010033	0.337	response to organic substance
GO:0008152	0.317	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.976	nucleoplasm
GO:0043232	0.549	intracellular non-membrane-bounded organelle
GO:0005737	0.336	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]