StarFunc result for job id P55345

User Input

>input (433 residues)
MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILIL
RQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQP
RTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLV
LQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVI
WPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCL
SEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLS
TGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPT
SQKVGEKVFPIWR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z3N3	0.892	0.892	4.315E-95	433	1.000	1.000	A0A0S2Z3N3.pdb.gz	A0A0S2Z3N3_HUMAN Protein arginine methyltransferase 2 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=PRMT2 PE=2 SV=1
2	AFDB:Q9R144	0.881	0.852	1.035E-81	448	0.801	0.775	Q9R144.pdb.gz	ANM2_MOUSE Protein arginine N-methyltransferase 2 OS=Mus musculus OX=10090 GN=Prmt2 PE=1 SV=1
3	AFDB:D9IVE5	0.777	0.779	4.692E-72	432	0.564	0.565	D9IVE5.pdb.gz	ANM2_XENLA Protein arginine N-methyltransferase 2 OS=Xenopus laevis OX=8355 GN=prmt2 PE=1 SV=2
4	AFDB:A1L1Q4	0.768	0.815	4.488E-68	408	0.510	0.542	A1L1Q4.pdb.gz	A1L1Q4_DANRE Protein arginine methyltransferase 2 OS=Danio rerio OX=7955 GN=prmt2 PE=1 SV=1
5	AFDB:Q6NWG4	0.730	0.900	7.518E-40	349	0.293	0.364	Q6NWG4.pdb.gz	ANM6_DANRE Protein arginine N-methyltransferase 6 OS=Danio rerio OX=7955 GN=prmt6 PE=2 SV=2
6	AFDB:Q9SU94	0.711	0.785	1.207E-39	390	0.303	0.336	Q9SU94.pdb.gz	ANM11_ARATH Protein arginine N-methyltransferase 1.1 OS=Arabidopsis thaliana OX=3702 GN=PRMT11 PE=1 SV=1
7	AFDB:Q4AE70	0.675	0.458	9.558E-39	651	0.293	0.195	Q4AE70.pdb.gz	CARM1_RAT Histone-arginine methyltransferase CARM1 OS=Rattus norvegicus OX=10116 GN=Carm1 PE=1 SV=1
8	AFDB:Q6NZB1	0.706	0.804	9.558E-39	378	0.314	0.360	Q6NZB1.pdb.gz	ANM6_MOUSE Protein arginine N-methyltransferase 6 OS=Mus musculus OX=10090 GN=Prmt6 PE=1 SV=2
9	AFDB:Q84W92	0.688	0.562	2.771E-38	535	0.270	0.219	Q84W92.pdb.gz	ANM13_ARATH Probable histone-arginine methyltransferase 1.3 OS=Arabidopsis thaliana OX=3702 GN=PRMT13 PE=1 SV=3
10	AFDB:O70467	0.686	0.567	2.940E-38	528	0.263	0.216	O70467.pdb.gz	ANM3_RAT Protein arginine N-methyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Prmt3 PE=1 SV=1
11	PDB:6nt2A	0.694	0.901	3.899E-38	330	0.252	0.330	6nt2A.pdb.gz	Anti-tumor Activity of the Type I PRMT Inhibitor, GSK3368715, Synergizes with PRMT5 Inhibition through MTAP Loss.
12	PDB:4y2hB	0.699	0.853	7.043E-38	352	0.296	0.364	4y2hB.pdb.gz	Aryl Pyrazoles as Potent Inhibitors of Arginine Methyltransferases: Identification of the First PRMT6 Tool Compound.
13	PDB:6dnzA	0.675	0.909	1.932E-36	317	0.229	0.312	6dnzA.pdb.gz	Structural Basis of Protein Arginine Methyltransferase Activation by a Catalytically Dead Homolog (Prozyme).
14	PDB:1g6q1	0.684	0.895	1.939E-35	328	0.254	0.335	1g6q1.pdb.gz
15	PDB:3r0qG	0.677	0.825	5.012E-34	353	0.254	0.312	3r0qG.pdb.gz	Crystal structure of the plant epigenetic protein arginine methyltransferase 10.
16	PDB:6dnzB	0.632	0.836	6.139E-27	319	0.173	0.235	6dnzB.pdb.gz	Structural Basis of Protein Arginine Methyltransferase Activation by a Catalytically Dead Homolog (Prozyme).
17	PDB:4lwpB	0.576	0.715	8.850E-24	342	0.203	0.257	4lwpB.pdb.gz	Crystal Structure of Arginine Methyltransferase 6 from Trypanosoma brucei
18	PDB:4g56A	0.529	0.383	7.493E-21	617	0.162	0.113	4g56A.pdb.gz	Structure of the arginine methyltransferase PRMT5-MEP50 reveals a mechanism for substrate specificity
19	PDB:7bo7AAA	0.519	0.372	2.305E-20	625	0.169	0.117	7bo7AAA.pdb.gz	CRYSTAL STRUCTURE OF THE HUMAN PRMT5:MEP50 COMPLEX with JNJB44355437
20	PDB:6ughA	0.510	0.384	3.486E-20	594	0.159	0.116	6ughA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z3N3	0.0	903	433	1.000	1.000	A0A0S2Z3N3_HUMAN Protein arginine methyltransferase 2 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=PRMT2 PE=2 SV=1
2	P55345	0.0	903	433	1.000	1.000	ANM2_HUMAN Protein arginine N-methyltransferase 2 OS=Homo sapiens OX=9606 GN=PRMT2 PE=1 SV=1
3	Q9R144	0.0	707	448	0.797	0.770	ANM2_MOUSE Protein arginine N-methyltransferase 2 OS=Mus musculus OX=10090 GN=Prmt2 PE=1 SV=1
4	D9IVE5	1.48e-178	507	432	0.554	0.556	ANM2_XENLA Protein arginine N-methyltransferase 2 OS=Xenopus laevis OX=8355 GN=prmt2 PE=1 SV=2
5	F1QDD1	1.42e-171	488	407	0.517	0.550	F1QDD1_DANRE Protein arginine N-methyltransferase 2 OS=Danio rerio OX=7955 GN=hrmt1l1 PE=4 SV=1
6	A1L1Q4	2.42e-171	488	408	0.513	0.544	A1L1Q4_DANRE Protein arginine methyltransferase 2 OS=Danio rerio OX=7955 GN=prmt2 PE=1 SV=1
7	Q6NWG4	3.49e-66	217	349	0.279	0.347	ANM6_DANRE Protein arginine N-methyltransferase 6 OS=Danio rerio OX=7955 GN=prmt6 PE=2 SV=2
8	O60678	4.72e-66	222	531	0.275	0.224	ANM3_HUMAN Protein arginine N-methyltransferase 3 OS=Homo sapiens OX=9606 GN=PRMT3 PE=1 SV=4
9	P38074	7.56e-66	216	348	0.268	0.333	HMT1_YEAST Protein arginine N-methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HMT1 PE=1 SV=1
10	Q6VRB0	1.42e-65	215	351	0.261	0.322	ANM1B_XENLA Protein arginine N-methyltransferase 1-B OS=Xenopus laevis OX=8355 GN=prmt1-b PE=1 SV=1
11	Q6NZB1	1.47e-65	216	378	0.296	0.339	ANM6_MOUSE Protein arginine N-methyltransferase 6 OS=Mus musculus OX=10090 GN=Prmt6 PE=1 SV=2
12	Q99873	1.47e-65	216	371	0.263	0.307	ANM1_HUMAN Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1 PE=1 SV=3
13	Q9SU94	1.88e-65	216	390	0.282	0.313	ANM11_ARATH Protein arginine N-methyltransferase 1.1 OS=Arabidopsis thaliana OX=3702 GN=PRMT11 PE=1 SV=1
14	Q9URX7	3.09e-65	214	340	0.282	0.359	ANM1_SCHPO Protein arginine N-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rmt1 PE=1 SV=2
15	Q63009	5.28e-65	214	353	0.261	0.320	ANM1_RAT Protein arginine N-methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Prmt1 PE=1 SV=1
16	Q9JIF0	9.57e-65	214	371	0.261	0.305	ANM1_MOUSE Protein arginine N-methyltransferase 1 OS=Mus musculus OX=10090 GN=Prmt1 PE=1 SV=1
17	O70467	1.60e-64	218	528	0.270	0.222	ANM3_RAT Protein arginine N-methyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Prmt3 PE=1 SV=1
18	Q8AV13	1.65e-64	213	369	0.256	0.301	ANM1A_XENLA Protein arginine N-methyltransferase 1-A OS=Xenopus laevis OX=8355 GN=prmt1-a PE=1 SV=1
19	F1R3J9	2.28e-64	212	348	0.261	0.325	F1R3J9_DANRE Protein arginine N-methyltransferase 1 OS=Danio rerio OX=7955 GN=fb39h07 PE=1 SV=1
20	Q9NR22	3.23e-64	213	394	0.254	0.279	ANM8_HUMAN Protein arginine N-methyltransferase 8 OS=Homo sapiens OX=9606 GN=PRMT8 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04857 CAF1	2.4e+02	12.4	CAF1 family ribonuclease
2	PF08241 Methyltransf_11	1.2	21.2	Methyltransferase domain
3	PF08242 Methyltransf_12	3.2e+02	13.5	Methyltransferase domain
4	PF12847 Methyltransf_18	46	15.5	Methyltransferase domain
5	PF13489 Methyltransf_23	5.3	18.3	Methyltransferase domain
6	PF13578 Methyltransf_24	89	15.6	Methyltransferase domain
7	PF13649 Methyltransf_25	0.012	27.6	Methyltransferase domain
8	PF13847 Methyltransf_31	3.1	19.0	Methyltransferase domain
9	PF02475 Met_10	2	19.7	Met-10+ like-protein
10	PF05175 MTS	0.00042	31.5	Methyltransferase small domain
11	PF06325 PrmA	0.02	25.9	Ribosomal protein L11 methyltransferase (PrmA)
12	PF05185 PRMT5	14	17.0	PRMT5 arginine-N-methyltransferase
13	PF00018 SH3_1	1.1e-06	39.4	SH3 domain
14	PF07653 SH3_2	1.2e-05	36.3	Variant SH3 domain
15	PF14604 SH3_9	4.2e-06	37.9	Variant SH3 domain
16	PF03848 TehB	33	15.3	Tellurite resistance protein TehB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380759

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405330	0.903	Estrogen receptor
2	9606.ENSP00000313829	0.775	KH domain-containing, RNA-binding, signal transduction-associated protein 1
3	9606.ENSP00000341826	0.736	Heterogeneous nuclear ribonucleoprotein A1
4	9606.ENSP00000442924	0.729	Histone-lysine N-methyltransferase SETD1B
5	9606.ENSP00000431962	0.685	Lethal(3)malignant brain tumor-like protein 3
6	9606.ENSP00000344456	0.659	Catenin beta-1
7	9606.ENSP00000333934	0.622	tRNA (guanine(10)-N2)-methyltransferase homolog
8	9606.ENSP00000338862	0.617	Ribosome biogenesis protein BRX1 homolog
9	9606.ENSP00000329915	0.603	Proteasome assembly chaperone 1
10	9606.ENSP00000392066	0.602	Disco-interacting protein 2 homolog A
11	9606.ENSP00000261015	0.601	Ribosome biogenesis protein WDR12
12	9606.ENSP00000274606	0.601	H/ACA ribonucleoprotein complex subunit 2
13	9606.ENSP00000387365	0.599	Periodic tryptophan protein 1 homolog
14	9606.ENSP00000221801	0.593	rRNA 2'-O-methyltransferase fibrillarin
15	9606.ENSP00000230340	0.592	Bystin
16	9606.ENSP00000232888	0.591	U3 small nucleolar RNA-interacting protein 2
17	9606.ENSP00000238146	0.589	ATP-dependent RNA helicase DDX55
18	9606.ENSP00000413572	0.580	Notchless protein homolog 1
19	9606.ENSP00000247003	0.576	Probable ATP-dependent RNA helicase DDX49
20	9606.ENSP00000333640	0.576	Eyes absent homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042054	0.999	histone methyltransferase activity
GO:0140297	0.995	DNA-binding transcription factor binding
GO:0008757	0.985	S-adenosylmethionine-dependent methyltransferase activity
GO:0016273	0.982	arginine N-methyltransferase activity
GO:0016274	0.945	protein-arginine N-methyltransferase activity
GO:0042802	0.936	identical protein binding
GO:0008469	0.877	histone arginine N-methyltransferase activity
GO:0061629	0.825	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0016922	0.777	nuclear receptor binding
GO:0003712	0.703	transcription coregulator activity
GO:0046966	0.697	nuclear thyroid hormone receptor binding
GO:0003676	0.466	nucleic acid binding
GO:0003713	0.465	transcription coactivator activity
GO:0003723	0.407	RNA binding
GO:0030331	0.390	nuclear estrogen receptor binding
GO:0042975	0.373	peroxisome proliferator activated receptor binding
GO:0042974	0.367	nuclear retinoic acid receptor binding
GO:0050681	0.362	nuclear androgen receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.995	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0051171	0.965	regulation of nitrogen compound metabolic process
GO:0031323	0.965	regulation of cellular metabolic process
GO:0060255	0.964	regulation of macromolecule metabolic process
GO:0006807	0.963	nitrogen compound metabolic process
GO:0019219	0.960	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.951	regulation of gene expression
GO:0043170	0.946	macromolecule metabolic process
GO:0048519	0.930	negative regulation of biological process
GO:0051252	0.930	regulation of RNA metabolic process
GO:0031326	0.929	regulation of cellular biosynthetic process
GO:0048523	0.918	negative regulation of cellular process
GO:0031324	0.910	negative regulation of cellular metabolic process
GO:0010556	0.909	regulation of macromolecule biosynthetic process
GO:0050896	0.903	response to stimulus
GO:0043412	0.892	macromolecule modification
GO:0044260	0.888	cellular macromolecule metabolic process
GO:0006355	0.853	regulation of DNA-templated transcription
GO:0043433	0.844	negative regulation of DNA-binding transcription factor activity
GO:1901564	0.769	organonitrogen compound metabolic process
GO:0033143	0.757	regulation of intracellular steroid hormone receptor signaling pathway
GO:0051172	0.694	negative regulation of nitrogen compound metabolic process
GO:0032259	0.688	methylation
GO:0008213	0.625	protein alkylation
GO:0043414	0.621	macromolecule methylation
GO:0010605	0.618	negative regulation of macromolecule metabolic process
GO:0006479	0.611	protein methylation
GO:0048518	0.546	positive regulation of biological process
GO:0048522	0.489	positive regulation of cellular process
GO:0045934	0.354	negative regulation of nucleobase-containing compound metabolic process
GO:0006725	0.348	cellular aromatic compound metabolic process
GO:0031327	0.331	negative regulation of cellular biosynthetic process
GO:0010558	0.325	negative regulation of macromolecule biosynthetic process
GO:0009893	0.320	positive regulation of metabolic process
GO:0051253	0.320	negative regulation of RNA metabolic process
GO:0034641	0.300	cellular nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0043232	0.328	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	0.999	Methyltransferases.

[back to server]