StarFunc result for job id P55347

User Input

>input (436 residues)
MMATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPPPVESQTPMDVDKQAIYR
HPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQEKEGKPFFCEDPETDNLMVK
AIQVLRIHLLELEKVNELCKDFCSRYIACLKTKMNSETLLSGEPGSPYSPVQSQQIQSAI
TGTISPQGIVVPASALQQGNVAMATVAGGTVYQPVTVVTPQGQVVTQTLSPGTIRIQNSQ
LQLQLNQDLSILHQDDGSSKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTN
LTLLQVNNWFINARRRILQPMLDSSCSETPKTKKKTAQNRPVQRFWPDSIASGVAQPPPS
ELTMSEGAVVTITTPVNMNVDSLQSLSSDGATLAVQQVMMAGQSEDESVDSTEEDAGALA
PAHISGLVLENSDSLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O70477	0.544	0.544	5.158E-57	436	0.961	0.961	O70477.pdb.gz	PKNX1_MOUSE Homeobox protein PKNOX1 OS=Mus musculus OX=10090 GN=Pknox1 PE=1 SV=3
2	AFDB:E7FBG0	0.528	0.518	9.255E-42	445	0.722	0.708	E7FBG0.pdb.gz
3	AFDB:A9JRT3	0.485	0.488	3.106E-39	433	0.672	0.677	A9JRT3.pdb.gz
4	AFDB:Q8BG99	0.497	0.462	1.741E-36	474	0.626	0.576	Q8BG99.pdb.gz	PKNX2_MOUSE Homeobox protein PKNOX2 OS=Mus musculus OX=10090 GN=Pknox2 PE=2 SV=1
5	AFDB:B8A551	0.331	0.356	6.407E-33	402	0.638	0.692	B8A551.pdb.gz
6	AFDB:O14770	0.394	0.361	2.433E-20	477	0.323	0.296	O14770.pdb.gz	MEIS2_HUMAN Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=2
7	AFDB:A0A2R8QIZ3	0.372	0.352	1.072E-19	463	0.314	0.296	A0A2R8QIZ3.pdb.gz
8	AFDB:O46339	0.383	0.345	1.425E-19	487	0.328	0.294	O46339.pdb.gz	HTH_DROME Homeobox protein homothorax OS=Drosophila melanogaster OX=7227 GN=hth PE=1 SV=1
9	AFDB:Q6NZT4	0.357	0.403	7.883E-19	380	0.319	0.366	Q6NZT4.pdb.gz
10	AFDB:A0A0G2JT27	0.365	0.399	3.097E-18	394	0.326	0.360	A0A0G2JT27.pdb.gz	A0A0G2JT27_RAT Meis homeobox 2 OS=Rattus norvegicus OX=10116 GN=Meis2 PE=3 SV=2
11	PDB:4egcA	0.108	0.088	3.715E-2	539	0.046	0.037	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:5ds9B	0.087	0.275	2.733E-1	98	0.034	0.153	5ds9B.pdb.gz	DNA Sequence Determinants Controlling Affinity, Stability and Shape of DNA Complexes Bound by the Nucleoid Protein Fis.
13	PDB:2hi3A	0.122	0.530	3.848E-1	73	0.037	0.219	2hi3A.pdb.gz
14	PDB:4czzB	0.099	0.264	6.073E-1	133	0.048	0.158	4czzB.pdb.gz	Differential Properties of Transcriptional Complexes Formed by the Corest Family.
15	PDB:6v7wE	0.082	0.140	1.074	234	0.041	0.077	6v7wE.pdb.gz	A phage-encoded anti-activator inhibits quorum sensing in Pseudomonas aeruginosa.
16	PDB:2ffhA	0.094	0.099	1.137	407	0.044	0.047	2ffhA.pdb.gz
17	PDB:5mrc66	0.081	0.108	1.512	305	0.064	0.092	5mrc66.pdb.gz	The structure of the yeast mitochondrial ribosome.
18	PDB:5nr5A	0.107	0.349	1.794	113	0.046	0.177	5nr5A.pdb.gz
19	PDB:7dvq7	0.072	0.325	2.831	81	0.032	0.173	7dvq7.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:7m5xA	0.113	0.055	3.556	1000	0.030	0.013	7m5xA.pdb.gz	Structural mechanisms for gating and ion selectivity of the human polyamine transporter ATP13A2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70477	0.0	868	436	0.961	0.961	PKNX1_MOUSE Homeobox protein PKNOX1 OS=Mus musculus OX=10090 GN=Pknox1 PE=1 SV=3
2	P55347	0.0	898	436	1.000	1.000	PKNX1_HUMAN Homeobox protein PKNOX1 OS=Homo sapiens OX=9606 GN=PKNOX1 PE=1 SV=3
3	Q90VY7	0.0	519	433	0.672	0.677	Q90VY7_DANRE Homeobox protein PKNOX1 OS=Danio rerio OX=7955 GN=fc13f10 PE=2 SV=1
4	Q96I87	0.0	898	436	1.000	1.000	Q96I87_HUMAN Homeobox-containing protein PKNOX1 OS=Homo sapiens OX=9606 GN=PKNOX1 PE=1 SV=1
5	Q96KN3	1.71e-159	460	472	0.626	0.578	PKNX2_HUMAN Homeobox protein PKNOX2 OS=Homo sapiens OX=9606 GN=PKNOX2 PE=1 SV=2
6	Q8BG99	4.19e-159	459	474	0.628	0.578	PKNX2_MOUSE Homeobox protein PKNOX2 OS=Mus musculus OX=10090 GN=Pknox2 PE=2 SV=1
7	Q7SZP3	1.15e-69	227	380	0.319	0.366	Q7SZP3_DANRE Homeobox protein Meis1 OS=Danio rerio OX=7955 GN=meis4.1a PE=1 SV=1
8	A0A0H2UKR5	6.56e-68	223	390	0.296	0.331	A0A0H2UKR5_DANRE Homeobox protein Meis2 isoform X6 OS=Danio rerio OX=7955 GN=fa26d08 PE=1 SV=1
9	D4A2T5	1.64e-67	224	469	0.317	0.294	D4A2T5_RAT Meis homeobox 2 OS=Rattus norvegicus OX=10116 GN=Meis2 PE=3 SV=3
10	A0A8I6AHY1	3.91e-67	221	400	0.291	0.318	A0A8I6AHY1_RAT Meis homeobox 2 OS=Rattus norvegicus OX=10116 GN=Meis2 PE=3 SV=1
11	O46339	3.91e-67	223	487	0.323	0.290	HTH_DROME Homeobox protein homothorax OS=Drosophila melanogaster OX=7227 GN=hth PE=1 SV=1
12	P97368	4.20e-67	220	378	0.280	0.323	MEIS3_MOUSE Homeobox protein Meis3 OS=Mus musculus OX=10090 GN=Meis3 PE=2 SV=2
13	O14770	2.13e-66	221	477	0.291	0.266	MEIS2_HUMAN Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=2
14	P97367	2.25e-66	221	477	0.291	0.266	MEIS2_MOUSE Homeobox protein Meis2 OS=Mus musculus OX=10090 GN=Meis2 PE=1 SV=2
15	Q9DDE0	4.54e-66	218	393	0.294	0.326	Q9DDE0_DANRE Meis homeobox 2a OS=Danio rerio OX=7955 GN=meis2.1 PE=1 SV=1
16	Q5U4X3	1.02e-65	219	453	0.294	0.283	MEI3A_XENLA Homeobox protein meis3-A OS=Xenopus laevis OX=8355 GN=meis3-a PE=2 SV=1
17	Q6PHK8	1.83e-65	216	397	0.289	0.317	Q6PHK8_DANRE Homeobox protein Meis2 OS=Danio rerio OX=7955 GN=meis2.2 PE=1 SV=1
18	Q9PTM7	3.15e-65	216	393	0.294	0.326	Q9PTM7_DANRE Meis homeobox 2b OS=Danio rerio OX=7955 GN=meis2.1 PE=1 SV=1
19	Q99687	5.44e-65	215	375	0.291	0.339	MEIS3_HUMAN Homeobox protein Meis3 OS=Homo sapiens OX=9606 GN=MEIS3 PE=1 SV=3
20	P79937	2.57e-64	213	390	0.284	0.318	MEIS1_XENLA Homeobox protein Meis1 OS=Xenopus laevis OX=8355 GN=meis1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	6.6e-16	69.3	Homeobox KN domain
2	PF00046 Homeodomain	0.00014	32.9	Homeodomain
3	PF16493 Meis_PKNOX_N	9.1e-37	136.5	N-terminal of Homeobox Meis and PKNOX1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000291547

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405890	0.987	Pre-B-cell leukemia transcription factor 1
2	9606.ENSP00000355140	0.940	Homeobox protein Hox-B1
3	9606.ENSP00000263253	0.912	Histone acetyltransferase p300
4	9606.ENSP00000419692	0.911	Retinoic acid receptor RXR-alpha
5	9606.ENSP00000388510	0.904	Retinoic acid receptor gamma
6	9606.ENSP00000254066	0.901	Retinoic acid receptor alpha
7	9606.ENSP00000361066	0.900	Nuclear receptor coactivator 3
8	9606.ENSP00000364190	0.899	Pre-B-cell leukemia transcription factor 2
9	9606.ENSP00000262965	0.814	Transcription factor E2-alpha
10	9606.ENSP00000349960	0.758	Actin, cytoplasmic 1
11	9606.ENSP00000262160	0.747	Mothers against decapentaplegic homolog 2
12	9606.ENSP00000296503	0.742	High mobility group protein B2
13	9606.ENSP00000272369	0.715	Homeobox protein Meis1
14	9606.ENSP00000251203	0.699	Pre-B-cell leukemia transcription factor 4
15	9606.ENSP00000362410	0.667	Transcription factor MafB
16	9606.ENSP00000331741	0.661	Homeobox protein Hox-B2
17	9606.ENSP00000367203	0.651	Lysine-specific demethylase 6A
18	9606.ENSP00000264010	0.645	Transcriptional repressor CTCF
19	9606.ENSP00000351446	0.637	WD repeat-containing protein 5
20	9606.ENSP00000363929	0.610	Nuclear receptor coactivator 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990837	0.997	sequence-specific double-stranded DNA binding
GO:0003700	0.996	DNA-binding transcription factor activity
GO:0000976	0.972	transcription cis-regulatory region binding
GO:0000981	0.967	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.955	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.863	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001216	0.312	DNA-binding transcription activator activity
GO:0001228	0.301	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.981	cellular process
GO:0050794	0.975	regulation of cellular process
GO:0019222	0.926	regulation of metabolic process
GO:0032501	0.911	multicellular organismal process
GO:0048856	0.908	anatomical structure development
GO:0071704	0.907	organic substance metabolic process
GO:0044238	0.898	primary metabolic process
GO:0044237	0.897	cellular metabolic process
GO:0006807	0.879	nitrogen compound metabolic process
GO:0032774	0.866	RNA biosynthetic process
GO:0006351	0.855	DNA-templated transcription
GO:0031323	0.839	regulation of cellular metabolic process
GO:0007275	0.837	multicellular organism development
GO:0048518	0.822	positive regulation of biological process
GO:0080090	0.789	regulation of primary metabolic process
GO:0006366	0.762	transcription by RNA polymerase II
GO:0048731	0.757	system development
GO:0051171	0.731	regulation of nitrogen compound metabolic process
GO:0060255	0.725	regulation of macromolecule metabolic process
GO:0010468	0.703	regulation of gene expression
GO:0019219	0.703	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.689	regulation of RNA metabolic process
GO:0031326	0.685	regulation of cellular biosynthetic process
GO:0010556	0.674	regulation of macromolecule biosynthetic process
GO:0009893	0.653	positive regulation of metabolic process
GO:0006355	0.588	regulation of DNA-templated transcription
GO:0048522	0.540	positive regulation of cellular process
GO:0010604	0.505	positive regulation of macromolecule metabolic process
GO:0051173	0.495	positive regulation of nitrogen compound metabolic process
GO:0030154	0.448	cell differentiation
GO:0006357	0.447	regulation of transcription by RNA polymerase II
GO:0045935	0.415	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.409	positive regulation of RNA metabolic process
GO:0010557	0.405	positive regulation of macromolecule biosynthetic process
GO:0031328	0.405	positive regulation of cellular biosynthetic process
GO:0048519	0.404	negative regulation of biological process
GO:0045893	0.404	positive regulation of DNA-templated transcription
GO:0048523	0.368	negative regulation of cellular process
GO:0050896	0.363	response to stimulus
GO:0045944	0.361	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005829	0.991	cytosol
GO:0032991	0.930	protein-containing complex
GO:0005654	0.916	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]