StarFunc result for job id P55735

User Input

>input (322 residues)
MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPV
WQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLIL
ACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIK
RFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRV
FIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCI
SDVNKGQGSVSASVTEGQQNEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G7NYT7	0.945	0.828	1.773E-51	368	0.991	0.867	G7NYT7.pdb.gz	G7NYT7_MACFA SEC13 homolog, nuclear pore and COPII coat complex component OS=Macaca fascicularis OX=9541 GN=SEC13 PE=3 SV=1
2	AFDB:Q7ZYJ8	0.973	0.979	6.504E-51	320	0.882	0.887	Q7ZYJ8.pdb.gz	Q7ZYJ8_XENLA SEC13 homolog, nuclear pore and COPII coat complex component S homeolog OS=Xenopus laevis OX=8355 GN=sec13.S PE=1 SV=1
3	AFDB:A0A2R8RKG2	0.974	0.934	5.153E-50	336	0.870	0.833	A0A2R8RKG2.pdb.gz
4	PDB:7wb4h	0.941	0.986	8.396E-49	307	0.854	0.896	7wb4h.pdb.gz
5	PDB:7r5jN0	0.912	0.974	7.744E-47	301	0.935	1.000	7r5jN0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
6	AFDB:Q9V3J4	0.896	0.813	1.008E-37	356	0.559	0.506	Q9V3J4.pdb.gz	SEC13_DROME Protein SEC13 homolog OS=Drosophila melanogaster OX=7227 GN=Sec13 PE=1 SV=1
7	AFDB:O94319	0.884	0.958	1.366E-35	297	0.475	0.515	O94319.pdb.gz	SEC13_SCHPO Protein transport protein sec13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec13 PE=1 SV=1
8	AFDB:O64740	0.878	0.935	4.551E-35	302	0.509	0.543	O64740.pdb.gz	SC13B_ARATH Protein transport protein SEC13 homolog B OS=Arabidopsis thaliana OX=3702 GN=SEC13B PE=1 SV=1
9	AFDB:Q04491	0.881	0.954	3.606E-34	297	0.469	0.508	Q04491.pdb.gz	SEC13_YEAST Protein transport protein SEC13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC13 PE=1 SV=1
10	AFDB:Q5B563	0.860	0.895	3.490E-32	309	0.466	0.485	Q5B563.pdb.gz	SEC13_EMENI Protein transport protein sec13 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sec13 PE=3 SV=1
11	AFDB:Q9N4A7	0.870	0.894	7.910E-32	313	0.410	0.422	Q9N4A7.pdb.gz	SEC13_CAEEL Protein SEC13 homolog OS=Caenorhabditis elegans OX=6239 GN=npp-20 PE=1 SV=1
12	PDB:3jroA	0.821	0.383	1.587E-28	701	0.469	0.215	3jroA.pdb.gz
13	AFDB:Q8I5B3	0.839	0.336	9.970E-27	822	0.345	0.135	Q8I5B3.pdb.gz	Q8I5B3_PLAF7 Protein transport protein SEC13 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1230700 PE=3 SV=1
14	PDB:6x08A	0.801	0.831	5.237E-23	310	0.295	0.306	6x08A.pdb.gz
15	PDB:7vciC	0.783	0.759	6.146E-21	333	0.326	0.315	7vciC.pdb.gz
16	PDB:6tblF	0.767	0.736	1.380E-15	336	0.227	0.217	6tblF.pdb.gz
17	PDB:3eweA	0.698	0.871	2.580E-15	255	0.261	0.329	3eweA.pdb.gz
18	PDB:3fm0A	0.758	0.745	6.489E-14	328	0.264	0.259	3fm0A.pdb.gz
19	PDB:2hesX	0.719	0.750	7.928E-13	308	0.211	0.221	2hesX.pdb.gz
20	PDB:6yw7C	0.688	0.641	1.713E-12	348	0.183	0.170	6yw7C.pdb.gz	Cryo-EM of human Arp2/3 complexes provides structural insights into actin nucleation modulation by ARPC5 isoforms.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MXL6	0.0	562	284	0.845	0.958	A8MXL6_HUMAN SEC13 homolog, nuclear pore and COPII coat complex component OS=Homo sapiens OX=9606 GN=SEC13 PE=1 SV=1
2	G7NYT7	0.0	655	368	0.991	0.867	G7NYT7_MACFA SEC13 homolog, nuclear pore and COPII coat complex component OS=Macaca fascicularis OX=9541 GN=SEC13 PE=3 SV=1
3	P55735	0.0	660	322	1.000	1.000	SEC13_HUMAN Protein SEC13 homolog OS=Homo sapiens OX=9606 GN=SEC13 PE=1 SV=3
4	Q5XFW8	0.0	647	322	0.972	0.972	SEC13_RAT Protein SEC13 homolog OS=Rattus norvegicus OX=10116 GN=Sec13 PE=1 SV=1
5	Q7T2E1	0.0	587	320	0.876	0.881	Q7T2E1_DANRE Protein SEC13 homolog OS=Danio rerio OX=7955 GN=zgc:63980 PE=1 SV=1
6	Q7ZYJ8	0.0	595	320	0.882	0.887	Q7ZYJ8_XENLA SEC13 homolog, nuclear pore and COPII coat complex component S homeolog OS=Xenopus laevis OX=8355 GN=sec13.S PE=1 SV=1
7	Q9D1M0	0.0	647	322	0.969	0.969	SEC13_MOUSE Protein SEC13 homolog OS=Mus musculus OX=10090 GN=Sec13 PE=1 SV=3
8	Q9V3J4	6.00e-125	363	356	0.553	0.500	SEC13_DROME Protein SEC13 homolog OS=Drosophila melanogaster OX=7227 GN=Sec13 PE=1 SV=1
9	O64740	3.28e-109	322	302	0.509	0.543	SC13B_ARATH Protein transport protein SEC13 homolog B OS=Arabidopsis thaliana OX=3702 GN=SEC13B PE=1 SV=1
10	O94319	9.55e-104	307	297	0.466	0.505	SEC13_SCHPO Protein transport protein sec13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec13 PE=1 SV=1
11	Q5B563	1.89e-100	299	309	0.478	0.498	SEC13_EMENI Protein transport protein sec13 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sec13 PE=3 SV=1
12	Q04491	4.04e-98	293	297	0.484	0.525	SEC13_YEAST Protein transport protein SEC13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC13 PE=1 SV=1
13	Q9N4A7	1.43e-84	259	313	0.413	0.425	SEC13_CAEEL Protein SEC13 homolog OS=Caenorhabditis elegans OX=6239 GN=npp-20 PE=1 SV=1
14	Q388I4	3.71e-55	185	374	0.385	0.332	Q388I4_TRYB2 Protein transport protein Sec13, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2630 PE=3 SV=1
15	Q8I5B3	2.17e-51	183	822	0.360	0.141	Q8I5B3_PLAF7 Protein transport protein SEC13 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1230700 PE=3 SV=1
16	Q4FZW5	5.60e-42	150	360	0.339	0.303	SEH1A_XENLA Nucleoporin SEH1-A OS=Xenopus laevis OX=8355 GN=seh1l-a PE=1 SV=1
17	Q96EE3	3.27e-41	149	360	0.329	0.294	SEH1_HUMAN Nucleoporin SEH1 OS=Homo sapiens OX=9606 GN=SEH1L PE=1 SV=3
18	Q8R2U0	6.41e-41	148	360	0.326	0.292	SEH1_MOUSE Nucleoporin SEH1 OS=Mus musculus OX=10090 GN=Seh1l PE=2 SV=1
19	Q384K7	1.63e-39	143	327	0.307	0.303	Q384K7_TRYB2 Protein transport protein sec13, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0420 PE=3 SV=1
20	Q10099	3.17e-39	143	339	0.289	0.274	SEH1_SCHPO Nucleoporin seh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=seh1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.00099	30.7	Anaphase-promoting complex subunit 4 WD40 domain
2	PF16529 Ge1_WD40	61	14.1	WD40 region of Ge1, enhancer of mRNA-decapping protein
3	PF20426 NBCH_WD40	20	15.5	Neurobeachin beta propeller domain
4	PF00400 WD40	1.5e-16	71.7	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373312

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229179	0.999	Nuclear pore complex protein Nup107
2	9606.ENSP00000245544	0.999	Nuclear pore complex protein Nup85
3	9606.ENSP00000261396	0.999	Nuclear pore complex protein Nup133
4	9606.ENSP00000306881	0.999	Protein transport protein Sec23A
5	9606.ENSP00000316032	0.999	Nuclear pore complex protein Nup98-Nup96
6	9606.ENSP00000325827	0.999	Protein transport protein Sec16A
7	9606.ENSP00000339881	0.999	GATOR complex protein MIOS
8	9606.ENSP00000342262	0.999	Nucleoporin Nup43
9	9606.ENSP00000367721	0.999	Nuclear pore complex protein Nup160
10	9606.ENSP00000378721	0.999	Protein transport protein Sec31A
11	9606.ENSP00000382779	0.999	Nucleoporin SEH1
12	9606.ENSP00000385432	0.999	GTP-binding protein SAR1b
13	9606.ENSP00000428564	0.999	Protein transport protein Sec24B
14	9606.ENSP00000448054	0.999	Nucleoporin Nup37
15	9606.ENSP00000262144	0.998	GATOR complex protein WDR59
16	9606.ENSP00000362339	0.998	GTP-binding protein SAR1a
17	9606.ENSP00000381823	0.998	Protein transport protein Sec24A
18	9606.ENSP00000293883	0.997	GATOR complex protein WDR24
19	9606.ENSP00000308339	0.997	Protein transport protein Sec16B
20	9606.ENSP00000338844	0.996	Protein transport protein Sec23B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.995	identical protein binding
GO:0097159	0.370	organic cyclic compound binding
GO:1901363	0.367	heterocyclic compound binding
GO:0003676	0.359	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051641	0.997	cellular localization
GO:0006810	0.996	transport
GO:0051649	0.959	establishment of localization in cell
GO:0048193	0.901	Golgi vesicle transport
GO:0046907	0.892	intracellular transport
GO:0071840	0.849	cellular component organization or biogenesis
GO:0065007	0.809	biological regulation
GO:0006888	0.795	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0050789	0.758	regulation of biological process
GO:0016043	0.736	cellular component organization
GO:0050794	0.720	regulation of cellular process
GO:0048518	0.458	positive regulation of biological process
GO:0033036	0.425	macromolecule localization
GO:0048522	0.331	positive regulation of cellular process
GO:0008104	0.330	protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0032991	0.995	protein-containing complex
GO:0005829	0.995	cytosol
GO:0012505	0.993	endomembrane system
GO:0005634	0.990	nucleus
GO:0016020	0.840	membrane
GO:0070013	0.839	intracellular organelle lumen
GO:0031981	0.833	nuclear lumen
GO:0005783	0.718	endoplasmic reticulum
GO:0005635	0.422	nuclear envelope
GO:0005654	0.402	nucleoplasm
GO:0140513	0.401	nuclear protein-containing complex
GO:0031090	0.399	organelle membrane
GO:0098588	0.387	bounding membrane of organelle
GO:0031982	0.384	vesicle
GO:0005643	0.343	nuclear pore
GO:0031410	0.302	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]