StarFunc result for job id P55771

User Input

>input (341 residues)
MEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARY
NETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSV
SSISRILRNKIGNLAQQGHYDSYKQHQPTPQPALPYNHIYSYPSPITAAAAKVPTPPGVP
AIPGSVAMPRTWPSSHSVTDILGIRSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHA
VNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGH
GWQHAGGTSLSPHNCDIPASLAFKGMQAAREGSHSVTASAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P47242	0.483	0.482	4.593E-48	342	0.985	0.982	P47242.pdb.gz	PAX9_MOUSE Paired box protein Pax-9 OS=Mus musculus OX=10090 GN=Pax9 PE=2 SV=1
2	AFDB:Q98865	0.448	0.446	8.939E-41	343	0.742	0.738	Q98865.pdb.gz	Q98865_DANRE Paired box 9 OS=Danio rerio OX=7955 GN=Pax9 PE=2 SV=1
3	AFDB:P09084	0.447	0.352	1.108E-32	446	0.633	0.484	P09084.pdb.gz	PAX1_MOUSE Paired box protein Pax-1 OS=Mus musculus OX=10090 GN=Pax1 PE=1 SV=4
4	AFDB:P15863	0.450	0.299	1.021E-31	534	0.645	0.412	P15863.pdb.gz	PAX1_HUMAN Paired box protein Pax-1 OS=Homo sapiens OX=9606 GN=PAX1 PE=1 SV=4
5	AFDB:Q98866	0.444	0.550	1.423E-29	270	0.563	0.711	Q98866.pdb.gz	Q98866_DANRE Paired box 9 OS=Danio rerio OX=7955 GN=Pax9 PE=2 SV=1
6	AFDB:A0A2R8PYI0	0.433	0.418	2.286E-28	353	0.525	0.507	A0A2R8PYI0.pdb.gz
7	AFDB:P23757	0.433	0.400	6.698E-23	370	0.443	0.408	P23757.pdb.gz	POXM_DROME Paired box pox-meso protein OS=Drosophila melanogaster OX=7227 GN=Poxm PE=2 SV=3
8	AFDB:F1R139	0.375	0.331	1.295E-21	386	0.364	0.321	F1R139.pdb.gz
9	AFDB:Q5SZP1	0.382	0.319	1.558E-21	409	0.393	0.328	Q5SZP1.pdb.gz	Q5SZP1_HUMAN Paired box 2 OS=Homo sapiens OX=9606 GN=PAX2 PE=1 SV=2
10	AFDB:Q02548	0.392	0.342	3.476E-21	391	0.381	0.332	Q02548.pdb.gz	PAX5_HUMAN Paired box protein Pax-5 OS=Homo sapiens OX=9606 GN=PAX5 PE=1 SV=1
11	PDB:2avuE	0.120	0.205	4.530E-2	156	0.059	0.128	2avuE.pdb.gz	Structure of the Escherichia coli FlhDC Complex, a Prokaryotic Heteromeric Regulator of Transcription.
12	PDB:1c0wD	0.100	0.179	7.894E-2	175	0.062	0.120	1c0wD.pdb.gz	Crystal structure of a cobalt-activated diphtheria toxin repressor-DNA complex reveals a metal-binding SH3-like domain.
13	PDB:2cg4A	0.118	0.245	1.293E-1	149	0.056	0.128	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
14	PDB:7cpuSN	0.112	0.223	1.293E-1	150	0.088	0.200	7cpuSN.pdb.gz	A male germ-cell-specific ribosome controls male fertility.
15	PDB:1c0wB	0.106	0.158	1.375E-1	219	0.062	0.096	1c0wB.pdb.gz	Crystal structure of a cobalt-activated diphtheria toxin repressor-DNA complex reveals a metal-binding SH3-like domain.
16	PDB:4v6wAN	0.102	0.211	1.873E-1	150	0.094	0.213	4v6wAN.pdb.gz	Structures of the human and Drosophila 80S ribosome.
17	PDB:7a1gY	0.103	0.218	1.873E-1	150	0.070	0.160	7a1gY.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
18	PDB:2gqqC	0.119	0.239	2.549E-1	157	0.050	0.108	2gqqC.pdb.gz
19	PDB:7pzyO	0.115	0.234	3.068E-1	150	0.076	0.173	7pzyO.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
20	PDB:5lzbz	0.121	0.074	3.692E-1	614	0.062	0.034	5lzbz.pdb.gz	The pathway to GTPase activation of elongation factor SelB on the ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P47242	0.0	682	342	0.985	0.982	PAX9_MOUSE Paired box protein Pax-9 OS=Mus musculus OX=10090 GN=Pax9 PE=2 SV=1
2	P55771	0.0	696	341	1.000	1.000	PAX9_HUMAN Paired box protein Pax-9 OS=Homo sapiens OX=9606 GN=PAX9 PE=1 SV=3
3	Q2L4T1	0.0	696	341	1.000	1.000	Q2L4T1_HUMAN Paired box gene 9 OS=Homo sapiens OX=9606 GN=Pax9 PE=2 SV=1
4	Q98865	0.0	510	343	0.742	0.738	Q98865_DANRE Paired box 9 OS=Danio rerio OX=7955 GN=Pax9 PE=2 SV=1
5	P09084	3.07e-134	391	446	0.633	0.484	PAX1_MOUSE Paired box protein Pax-1 OS=Mus musculus OX=10090 GN=Pax1 PE=1 SV=4
6	Q98866	1.41e-133	383	270	0.545	0.689	Q98866_DANRE Paired box 9 OS=Danio rerio OX=7955 GN=Pax9 PE=2 SV=1
7	P15863	8.30e-132	388	534	0.636	0.406	PAX1_HUMAN Paired box protein Pax-1 OS=Homo sapiens OX=9606 GN=PAX1 PE=1 SV=4
8	B0S7C8	9.81e-116	340	340	0.516	0.518	B0S7C8_DANRE Paired box 1b OS=Danio rerio OX=7955 GN=pax1b PE=4 SV=1
9	P23757	1.32e-78	246	370	0.340	0.314	POXM_DROME Paired box pox-meso protein OS=Drosophila melanogaster OX=7227 GN=Poxm PE=2 SV=3
10	Q21272	5.32e-63	202	257	0.267	0.354	PAX1H_CAEEL Paired box protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=pax-1 PE=2 SV=1
11	Q9PTX1	2.16e-62	205	394	0.279	0.241	Q9PTX1_CHICK Paired-box containing protein Pax-2 OS=Gallus gallus OX=9031 GN=Pax-2 PE=2 SV=1
12	A0A0G2JZ47	2.98e-62	205	394	0.279	0.241	A0A0G2JZ47_RAT Paired box 2 OS=Rattus norvegicus OX=10116 GN=Pax2 PE=4 SV=2
13	Q5SZP1	4.15e-62	205	409	0.279	0.232	Q5SZP1_HUMAN Paired box 2 OS=Homo sapiens OX=9606 GN=PAX2 PE=1 SV=2
14	Q02962	8.64e-62	204	417	0.279	0.228	PAX2_HUMAN Paired box protein Pax-2 OS=Homo sapiens OX=9606 GN=PAX2 PE=1 SV=4
15	Q0IH87	9.04e-62	206	483	0.284	0.201	PAX3B_XENLA Paired box protein Pax-3-B OS=Xenopus laevis OX=8355 GN=pax3-b PE=2 SV=2
16	Q90268	2.69e-61	203	410	0.326	0.271	PAX2A_DANRE Paired box protein Pax-2a OS=Danio rerio OX=7955 GN=pax2a PE=2 SV=2
17	G3V5S4	4.57e-61	199	304	0.273	0.306	G3V5S4_HUMAN Paired box 2 (Fragment) OS=Homo sapiens OX=9606 GN=PAX2 PE=1 SV=2
18	O93370	7.49e-61	201	386	0.273	0.241	O93370_DANRE Paired box 2b OS=Danio rerio OX=7955 GN=Pax2.2 PE=2 SV=1
19	A0A0A0MRH7	1.48e-60	201	393	0.273	0.237	A0A0A0MRH7_HUMAN Paired box 2 OS=Homo sapiens OX=9606 GN=PAX2 PE=1 SV=1
20	E7ERW5	1.75e-60	197	295	0.273	0.315	E7ERW5_HUMAN Paired box 5 OS=Homo sapiens OX=9606 GN=PAX5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13384 HTH_23	0.0017	29.4	Homeodomain-like domain
2	PF13551 HTH_29	25	16.3	Winged helix-turn helix
3	PF13565 HTH_32	0.0085	28.0	Homeodomain-like domain
4	PF00292 PAX	1e-62	221.0	'Paired box' domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355245

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000372170	0.987	Homeobox protein MSX-1
2	9606.ENSP00000356234	0.977	Lysine-specific demethylase 5B
3	9606.ENSP00000258829	0.800	Homeobox protein Nkx-2.8
4	9606.ENSP00000361547	0.739	Paired mesoderm homeobox protein 2
5	9606.ENSP00000329452	0.713	Mitochondrial 2-oxodicarboxylate carrier
6	9606.ENSP00000371875	0.713	Homeobox protein Nkx-3.2
7	9606.ENSP00000258443	0.706	Tumor necrosis factor receptor superfamily member EDAR
8	9606.ENSP00000253968	0.702	Homeobox protein BarH-like 1
9	9606.ENSP00000335076	0.697	Ectodysplasin-A receptor-associated adapter protein
10	9606.ENSP00000302625	0.681	Axin-2
11	9606.ENSP00000245451	0.672	Bone morphogenetic protein 4
12	9606.ENSP00000258411	0.667	Protein Wnt-10a
13	9606.ENSP00000414657	0.667	Protein odd-skipped-related 2
14	9606.ENSP00000363804	0.658	Krueppel-like factor 4
15	9606.ENSP00000239461	0.651	Paired mesoderm homeobox protein 1
16	9606.ENSP00000455426	0.647	Zinc finger protein 423
17	9606.ENSP00000239243	0.641	Homeobox protein MSX-2
18	9606.ENSP00000294638	0.625	LIM/homeobox protein Lhx8
19	9606.ENSP00000337439	0.623	Dapper homolog 1
20	9606.ENSP00000362390	0.619	T-box transcription factor TBX22

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0003700	0.967	DNA-binding transcription factor activity
GO:0000976	0.967	transcription cis-regulatory region binding
GO:0000981	0.925	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515	0.888	protein binding
GO:0000977	0.771	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001216	0.566	DNA-binding transcription activator activity
GO:0001228	0.529	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0032502	0.988	developmental process
GO:0048856	0.983	anatomical structure development
GO:0009889	0.978	regulation of biosynthetic process
GO:0006355	0.971	regulation of DNA-templated transcription
GO:0048519	0.900	negative regulation of biological process
GO:0048518	0.834	positive regulation of biological process
GO:0032501	0.810	multicellular organismal process
GO:0007275	0.765	multicellular organism development
GO:0048522	0.752	positive regulation of cellular process
GO:0009987	0.681	cellular process
GO:0009893	0.680	positive regulation of metabolic process
GO:0048513	0.656	animal organ development
GO:0009892	0.654	negative regulation of metabolic process
GO:0048523	0.644	negative regulation of cellular process
GO:0006357	0.625	regulation of transcription by RNA polymerase II
GO:0010604	0.622	positive regulation of macromolecule metabolic process
GO:0051173	0.596	positive regulation of nitrogen compound metabolic process
GO:0031325	0.570	positive regulation of cellular metabolic process
GO:0050896	0.569	response to stimulus
GO:0048731	0.567	system development
GO:0010605	0.531	negative regulation of macromolecule metabolic process
GO:0009653	0.489	anatomical structure morphogenesis
GO:0031324	0.479	negative regulation of cellular metabolic process
GO:0031328	0.469	positive regulation of cellular biosynthetic process
GO:0010557	0.454	positive regulation of macromolecule biosynthetic process
GO:0045935	0.451	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.435	positive regulation of DNA-templated transcription
GO:0051172	0.380	negative regulation of nitrogen compound metabolic process
GO:0045944	0.378	positive regulation of transcription by RNA polymerase II
GO:0050793	0.316	regulation of developmental process
GO:0009887	0.304	animal organ morphogenesis
GO:0009888	0.303	tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043228	0.983	non-membrane-bounded organelle
GO:0043232	0.965	intracellular non-membrane-bounded organelle
GO:0032991	0.913	protein-containing complex
GO:0005730	0.769	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]