StarFunc result for job id P55809

User Input

>input (520 residues)
MAALKLLSSGLRLCASARGSGATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGATVL
VGGFGLCGIPENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENA
EFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSV
AIASKPREVREFNGQHFILEEAITGDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAET
TVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIERLSIRKEGDGEAKSAKPGDD
VRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEAD
ADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMV
KGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDK
KKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQQIAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R040	0.927	0.927	0.000	520	1.000	1.000	A0A024R040.pdb.gz	A0A024R040_HUMAN Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Homo sapiens OX=9606 GN=OXCT1 PE=2 SV=1
2	AFDB:Q29551	0.957	0.957	1.682E-103	520	0.898	0.898	Q29551.pdb.gz	SCOT1_PIG Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Sus scrofa OX=9823 GN=OXCT1 PE=1 SV=2
3	AFDB:Q9BYC2	0.949	0.954	1.779E-94	517	0.742	0.747	Q9BYC2.pdb.gz	SCOT2_HUMAN Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT2 PE=2 SV=2
4	PDB:1m3eB	0.903	0.993	1.373E-93	473	0.842	0.926	1m3eB.pdb.gz
5	AFDB:Q9ESL0	0.921	0.921	1.446E-88	520	0.675	0.675	Q9ESL0.pdb.gz	SCO2B_MOUSE Succinyl-CoA:3-ketoacid coenzyme A transferase 2B, mitochondrial OS=Mus musculus OX=10090 GN=Oxct2b PE=2 SV=1
6	PDB:1opeA	0.868	0.997	5.062E-88	453	0.812	0.932	1opeA.pdb.gz
7	AFDB:Q09450	0.944	0.942	1.392E-82	521	0.613	0.612	Q09450.pdb.gz	SCOT_CAEEL Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=C05C10.3 PE=3 SV=1
8	PDB:1o9lB	0.813	0.995	3.473E-82	425	0.754	0.922	1o9lB.pdb.gz	Succinate:Coenzyme-A Transferase Deficiency: A Structural View of Pathogenic Mutations
9	AFDB:Q54JD9	0.923	0.943	1.332E-81	509	0.613	0.627	Q54JD9.pdb.gz	SCOT_DICDI Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=oxct1 PE=3 SV=1
10	AFDB:Q9W058	0.937	0.944	1.669E-81	516	0.594	0.599	Q9W058.pdb.gz	SCOT_DROME Succinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=SCOT PE=1 SV=1
11	PDB:4kgbA	0.878	0.979	7.280E-77	466	0.563	0.629	4kgbA.pdb.gz
12	AFDB:Q386P1	0.904	0.953	1.490E-72	493	0.483	0.509	Q386P1.pdb.gz	Q386P1_TRYB2 Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0290 PE=1 SV=1
13	AFDB:G8BJM6	0.919	0.942	1.444E-70	507	0.490	0.503	G8BJM6.pdb.gz	G8BJM6_CANPC Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=OSC1 PE=3 SV=1
14	PDB:6lp1C	0.875	0.969	2.912E-69	469	0.475	0.527	6lp1C.pdb.gz	The ASCT/SCS cycle fuels mitochondrial ATP and acetate production in Trypanosoma brucei.
15	AFDB:Q8X5X6	0.706	0.693	4.404E-35	531	0.210	0.205	Q8X5X6.pdb.gz	YDIF_ECO57 Acetate CoA-transferase YdiF OS=Escherichia coli O157:H7 OX=83334 GN=ydiF PE=1 SV=1
16	PDB:2ahuA	0.708	0.715	6.613E-35	515	0.215	0.217	2ahuA.pdb.gz
17	PDB:3rrlA	0.435	0.975	1.223E-30	230	0.262	0.591	3rrlA.pdb.gz
18	PDB:3rrlB	0.386	0.958	3.927E-27	207	0.229	0.575	3rrlB.pdb.gz
19	PDB:5dbnF	0.389	0.929	3.805E-25	214	0.188	0.458	5dbnF.pdb.gz
20	PDB:4eu5A	0.519	0.525	1.872E-14	513	0.138	0.140	4eu5A.pdb.gz	Crystal Structures of Acetobacter aceti Succinyl-Coenzyme A (CoA):Acetate CoA-Transferase Reveal Specificity Determinants and Illustrate the Mechanism Used by Class I CoA-Transferases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R040	0.0	1072	520	1.000	1.000	A0A024R040_HUMAN Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Homo sapiens OX=9606 GN=OXCT1 PE=2 SV=1
2	B2GV06	0.0	988	520	0.919	0.919	SCOT1_RAT Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Oxct1 PE=1 SV=1
3	P55809	0.0	1072	520	1.000	1.000	SCOT1_HUMAN Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1 PE=1 SV=1
4	Q09450	0.0	652	521	0.608	0.607	SCOT_CAEEL Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=C05C10.3 PE=3 SV=1
5	Q29551	0.0	953	520	0.898	0.898	SCOT1_PIG Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Sus scrofa OX=9823 GN=OXCT1 PE=1 SV=2
6	Q54JD9	0.0	658	509	0.625	0.639	SCOT_DICDI Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=oxct1 PE=3 SV=1
7	Q9BYC2	0.0	786	517	0.742	0.747	SCOT2_HUMAN Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT2 PE=2 SV=2
8	Q9D0K2	0.0	962	520	0.921	0.921	SCOT1_MOUSE Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Oxct1 PE=1 SV=1
9	Q9ESL0	0.0	697	520	0.654	0.654	SCO2B_MOUSE Succinyl-CoA:3-ketoacid coenzyme A transferase 2B, mitochondrial OS=Mus musculus OX=10090 GN=Oxct2b PE=2 SV=1
10	Q9JJN4	0.0	698	520	0.654	0.654	SCO2A_MOUSE Succinyl-CoA:3-ketoacid coenzyme A transferase 2A, mitochondrial OS=Mus musculus OX=10090 GN=Oxct2a PE=2 SV=2
11	Q9W058	0.0	644	516	0.587	0.591	SCOT_DROME Succinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=SCOT PE=1 SV=1
12	Q386P1	3.14e-175	504	493	0.490	0.517	Q386P1_TRYB2 Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0290 PE=1 SV=1
13	G8BJM6	2.43e-170	493	507	0.494	0.507	G8BJM6_CANPC Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=OSC1 PE=3 SV=1
14	P56006	3.92e-91	280	232	0.267	0.599	SCOA_HELPY Succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=scoA PE=1 SV=1
15	Q9I2B0	3.77e-86	267	232	0.275	0.616	Q9I2B0_PSEAE 3-oxoadipate CoA-transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=dhcA PE=3 SV=1
16	P9WPW3	1.40e-81	255	218	0.244	0.583	SCOB_MYCTU Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=scoB PE=1 SV=1
17	P56007	9.71e-77	242	207	0.229	0.575	SCOB_HELPY Succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=scoB PE=1 SV=1
18	Q9I2A9	3.94e-66	215	218	0.206	0.491	Q9I2A9_PSEAE 3-oxoadipate CoA-transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=dhcB PE=3 SV=1
19	P76459	2.75e-59	197	216	0.194	0.468	ATOA_ECOLI Acetate CoA-transferase subunit beta OS=Escherichia coli (strain K12) OX=83333 GN=atoA PE=1 SV=1
20	P33752	2.25e-46	163	218	0.158	0.376	CTFA_CLOAB Acetoacetyl-CoA:acetate/butyrate CoA transferase alpha subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=ctfA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13336 AcetylCoA_hyd_C	10	17.5	Acetyl-CoA hydrolase/transferase C-terminal domain
2	PF01144 CoA_trans	8.7e-125	425.8	Coenzyme A transferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000196371

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376184	0.981	D-beta-hydroxybutyrate dehydrogenase, mitochondrial
2	9606.ENSP00000265838	0.976	Acetyl-CoA acetyltransferase, mitochondrial
3	9606.ENSP00000363614	0.971	Hydroxymethylglutaryl-CoA lyase, mitochondrial
4	9606.ENSP00000296424	0.965	3-hydroxybutyrate dehydrogenase type 2
5	9606.ENSP00000358414	0.964	Hydroxymethylglutaryl-CoA synthase, mitochondrial
6	9606.ENSP00000356015	0.959	Acetyl-CoA acetyltransferase, cytosolic
7	9606.ENSP00000381654	0.943	3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic
8	9606.ENSP00000322706	0.940	Hydroxymethylglutaryl-CoA synthase, cytoplasmic
9	9606.ENSP00000231887	0.934	Peroxisomal bifunctional enzyme
10	9606.ENSP00000324842	0.924	Acetoacetyl-CoA synthetase
11	9606.ENSP00000285093	0.920	3-ketoacyl-CoA thiolase, mitochondrial
12	9606.ENSP00000333664	0.914	3-ketoacyl-CoA thiolase, peroxisomal
13	9606.ENSP00000452762	0.912	Electron transfer flavoprotein subunit alpha, mitochondrial
14	9606.ENSP00000361914	0.890	Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial
15	9606.ENSP00000325136	0.889	hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
16	9606.ENSP00000367923	0.865	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
17	9606.ENSP00000377446	0.862	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
18	9606.ENSP00000346173	0.857	Electron transfer flavoprotein subunit beta
19	9606.ENSP00000416583	0.827	Deoxyribose-phosphate aldolase
20	9606.ENSP00000322450	0.812	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008260	1.000	succinyl-CoA:3-oxo-acid CoA-transferase activity
GO:0005515	0.998	protein binding
GO:0042802	0.782	identical protein binding
GO:0046983	0.479	protein dimerization activity
GO:0042803	0.471	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0044281	0.990	small molecule metabolic process
GO:0071704	0.655	organic substance metabolic process
GO:0044238	0.467	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.909	intracellular organelle lumen
GO:0005759	0.618	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24564	1.000	a 3-oxo acid + succinyl-CoA = a 3-oxoacyl-CoA + succinate
EC:2.8.3.5	1.000	3-oxoacid CoA-transferase.

[back to server]