StarFunc result for job id P55854

User Input

>input (103 residues)
MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFR
FDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Z172	0.811	0.761	6.534E-19	110	0.893	0.836	Q9Z172.pdb.gz	SUMO3_MOUSE Small ubiquitin-related modifier 3 OS=Mus musculus OX=10090 GN=Sumo3 PE=1 SV=1
2	AFDB:Q6EEV6	0.767	0.830	1.562E-16	95	0.767	0.832	Q6EEV6.pdb.gz	SUMO4_HUMAN Small ubiquitin-related modifier 4 OS=Homo sapiens OX=9606 GN=SUMO4 PE=1 SV=3
3	AFDB:O97102	0.800	0.912	1.986E-15	90	0.602	0.689	O97102.pdb.gz	O97102_DROME Small ubiquitin-related modifier OS=Drosophila melanogaster OX=7227 GN=Sumo PE=1 SV=1
4	PDB:1wz0A	0.686	0.680	3.260E-14	104	0.864	0.856	1wz0A.pdb.gz
5	AFDB:P55853	0.758	0.854	5.069E-13	91	0.388	0.440	P55853.pdb.gz	SUMO_CAEEL Small ubiquitin-related modifier OS=Caenorhabditis elegans OX=6239 GN=smo-1 PE=1 SV=1
6	AFDB:Q8N0B4	0.776	0.815	5.775E-13	98	0.485	0.510	Q8N0B4.pdb.gz	Q8N0B4_DICDI Small ubiquitin-like protein OS=Dictyostelium discoideum OX=44689 GN=SUMO PE=2 SV=1
7	AFDB:O57686	0.774	0.781	6.579E-13	102	0.456	0.461	O57686.pdb.gz	SMO1A_XENLA Small ubiquitin-related modifier 1-A OS=Xenopus laevis OX=8355 GN=sumo1-a PE=1 SV=1
8	AFDB:G2XKQ0	0.750	0.764	1.108E-12	101	0.417	0.426	G2XKQ0.pdb.gz	SUMO5_HUMAN Small ubiquitin-related modifier 5 OS=Homo sapiens OX=9606 GN=SUMO1P1 PE=1 SV=2
9	AFDB:Q8I444	0.743	0.764	1.263E-12	100	0.417	0.430	Q8I444.pdb.gz	Q8I444_PLAF7 Small ubiquitin-related modifier OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0505800 PE=4 SV=1
10	AFDB:P55852	0.774	0.797	1.536E-12	100	0.466	0.480	P55852.pdb.gz	SUMO1_ARATH Small ubiquitin-related modifier 1 OS=Arabidopsis thaliana OX=3702 GN=SUMO1 PE=1 SV=2
11	AFDB:O13351	0.770	0.682	2.271E-12	117	0.456	0.402	O13351.pdb.gz	PMT3_SCHPO Ubiquitin-like protein pmt3/smt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pmt3 PE=1 SV=2
12	PDB:2k1fA	0.610	0.697	1.704E-11	88	0.602	0.705	2k1fA.pdb.gz
13	PDB:5xqmA	0.653	0.737	3.204E-10	90	0.388	0.444	5xqmA.pdb.gz
14	PDB:3pgeA	0.691	0.422	3.350E-9	172	0.359	0.215	3pgeA.pdb.gz
15	PDB:6rpqA	0.717	0.304	5.644E-9	249	0.359	0.149	6rpqA.pdb.gz
16	PDB:1a5rA	0.593	0.593	7.326E-9	103	0.466	0.466	1a5rA.pdb.gz
17	PDB:3tixA	0.709	0.484	1.083E-8	153	0.359	0.242	3tixA.pdb.gz
18	PDB:6mdhA	0.653	0.461	9.315E-8	149	0.107	0.074	6mdhA.pdb.gz
19	PDB:3dbhI	0.647	0.760	2.321E-7	86	0.136	0.163	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
20	PDB:7rbsB	0.675	0.454	3.909E-7	157	0.097	0.064	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P55854	7.15e-74	215	103	1.000	1.000	SUMO3_HUMAN Small ubiquitin-related modifier 3 OS=Homo sapiens OX=9606 GN=SUMO3 PE=1 SV=2
2	Q9Z172	1.36e-64	192	110	0.893	0.836	SUMO3_MOUSE Small ubiquitin-related modifier 3 OS=Mus musculus OX=10090 GN=Sumo3 PE=1 SV=1
3	Q6NV25	1.27e-63	189	94	0.874	0.957	SMO3L_DANRE Small ubiquitin-related modifier 3-like OS=Danio rerio OX=7955 GN=sumo3l PE=3 SV=1
4	P61956	7.23e-63	187	95	0.883	0.958	SUMO2_HUMAN Small ubiquitin-related modifier 2 OS=Homo sapiens OX=9606 GN=SUMO2 PE=1 SV=3
5	P61957	7.23e-63	187	95	0.883	0.958	SUMO2_MOUSE Small ubiquitin-related modifier 2 OS=Mus musculus OX=10090 GN=Sumo2 PE=1 SV=1
6	P61959	7.23e-63	187	95	0.883	0.958	SUMO2_RAT Small ubiquitin-related modifier 2 OS=Rattus norvegicus OX=10116 GN=Sumo2 PE=1 SV=1
7	Q6DHL4	1.16e-61	184	96	0.864	0.927	SUMO2_DANRE Small ubiquitin-related modifier 2 OS=Danio rerio OX=7955 GN=sumo2 PE=3 SV=1
8	Q6EEV6	8.57e-51	157	95	0.757	0.821	SUMO4_HUMAN Small ubiquitin-related modifier 4 OS=Homo sapiens OX=9606 GN=SUMO4 PE=1 SV=3
9	O97102	6.89e-43	137	90	0.650	0.744	O97102_DROME Small ubiquitin-related modifier OS=Drosophila melanogaster OX=7227 GN=Sumo PE=1 SV=1
10	Q8N0B4	1.76e-26	95.9	98	0.495	0.520	Q8N0B4_DICDI Small ubiquitin-like protein OS=Dictyostelium discoideum OX=44689 GN=SUMO PE=2 SV=1
11	A7WLH8	5.19e-26	94.7	101	0.427	0.436	SUMO1_PIG Small ubiquitin-related modifier 1 OS=Sus scrofa OX=9823 GN=SUMO1 PE=3 SV=1
12	P63165	5.19e-26	94.7	101	0.427	0.436	SUMO1_HUMAN Small ubiquitin-related modifier 1 OS=Homo sapiens OX=9606 GN=SUMO1 PE=1 SV=1
13	P63166	5.19e-26	94.7	101	0.427	0.436	SUMO1_MOUSE Small ubiquitin-related modifier 1 OS=Mus musculus OX=10090 GN=Sumo1 PE=1 SV=1
14	Q5I0H3	5.19e-26	94.7	101	0.427	0.436	SUMO1_RAT Small ubiquitin-related modifier 1 OS=Rattus norvegicus OX=10116 GN=Sumo1 PE=1 SV=1
15	G2XKQ0	3.83e-25	92.4	101	0.408	0.416	SUMO5_HUMAN Small ubiquitin-related modifier 5 OS=Homo sapiens OX=9606 GN=SUMO1P1 PE=1 SV=2
16	O13351	5.90e-25	92.4	117	0.456	0.402	PMT3_SCHPO Ubiquitin-like protein pmt3/smt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pmt3 PE=1 SV=2
17	P55853	6.24e-25	91.7	91	0.398	0.451	SUMO_CAEEL Small ubiquitin-related modifier OS=Caenorhabditis elegans OX=6239 GN=smo-1 PE=1 SV=1
18	Q7SZR5	1.01e-23	89.0	100	0.437	0.450	SUMO1_DANRE Small ubiquitin-related modifier 1 OS=Danio rerio OX=7955 GN=sumo1 PE=3 SV=1
19	P55852	2.44e-23	87.8	100	0.437	0.450	SUMO1_ARATH Small ubiquitin-related modifier 1 OS=Arabidopsis thaliana OX=3702 GN=SUMO1 PE=1 SV=2
20	Q57Z72	3.54e-23	87.8	114	0.388	0.351	Q57Z72_TRYB2 Small ubiquitin protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.260 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18099 DUF5010_C	3.9e+02	12.7	DUF5010 C-terminal domain
2	PF11976 Rad60-SLD	2.1e-22	90.1	Ubiquitin-2 like Rad60 SUMO-like
3	PF00240 ubiquitin	6.3e-09	46.8	Ubiquitin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000024078

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000012969	0.996	Ubiquitin-conjugating enzyme E2I
2	9598.ENSPTRP00000008330	0.992	Uncharacterized protein
3	9598.ENSPTRP00000060506	0.985	Small ubiquitin-related modifier
4	9598.ENSPTRP00000021122	0.979	E3 SUMO-protein ligase RanBP2
5	9598.ENSPTRP00000019221	0.955	Ubiquitin-like 1-activating enzyme E1A
6	9598.ENSPTRP00000014836	0.940	Cellular tumor antigen p53
7	9598.ENSPTRP00000018512	0.937	Ubiquitin-like modifier activating enzyme 2
8	9598.ENSPTRP00000027018	0.932	SUMO1/sentrin/SMT3 specific peptidase 2
9	9598.ENSPTRP00000044045	0.931	Ran GTPase activating protein 1
10	9598.ENSPTRP00000017001	0.926	Protein inhibitor of activated STAT, 2
11	9598.ENSPTRP00000060824	0.923	Protein inhibitor of activated STAT, 1
12	9598.ENSPTRP00000017489	0.903	Protein inhibitor of activated STAT, 4
13	9598.ENSPTRP00000030818	0.885	Death-domain associated protein
14	9598.ENSPTRP00000027165	0.881	SUMO1/sentrin specific peptidase 5
15	9598.ENSPTRP00000012754	0.875	Uncharacterized protein
16	9598.ENSPTRP00000002056	0.870	Protein inhibitor of activated STAT, 3
17	9598.ENSPTRP00000031374	0.854	SUMO1/sentrin specific peptidase 6
18	9598.ENSPTRP00000043417	0.851	Ubiquitin interaction motif containing 1
19	9598.ENSPTRP00000012429	0.850	Pan troglodytes promyelocytic leukemia (PML), mRNA
20	9598.ENSPTRP00000022674	0.847	Proliferating cell nuclear antigen

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036211	0.997	protein modification process
GO:0050794	0.990	regulation of cellular process
GO:0019222	0.989	regulation of metabolic process
GO:0009987	0.986	cellular process
GO:0018205	0.979	peptidyl-lysine modification
GO:0070647	0.977	protein modification by small protein conjugation or removal
GO:0032446	0.963	protein modification by small protein conjugation
GO:0060255	0.960	regulation of macromolecule metabolic process
GO:0051171	0.959	regulation of nitrogen compound metabolic process
GO:0080090	0.958	regulation of primary metabolic process
GO:0031323	0.955	regulation of cellular metabolic process
GO:0016925	0.949	protein sumoylation
GO:0048518	0.807	positive regulation of biological process
GO:0019219	0.756	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.626	positive regulation of cellular process
GO:0010468	0.584	regulation of gene expression
GO:0031326	0.582	regulation of cellular biosynthetic process
GO:0010556	0.571	regulation of macromolecule biosynthetic process
GO:0051252	0.570	regulation of RNA metabolic process
GO:2001141	0.533	regulation of RNA biosynthetic process
GO:1903506	0.516	regulation of nucleic acid-templated transcription
GO:0032502	0.494	developmental process
GO:0050896	0.492	response to stimulus
GO:0032501	0.482	multicellular organismal process
GO:0006355	0.478	regulation of DNA-templated transcription
GO:0065009	0.464	regulation of molecular function
GO:0009893	0.445	positive regulation of metabolic process
GO:0051173	0.441	positive regulation of nitrogen compound metabolic process
GO:0010604	0.441	positive regulation of macromolecule metabolic process
GO:0031325	0.421	positive regulation of cellular metabolic process
GO:0048856	0.383	anatomical structure development
GO:0044237	0.358	cellular metabolic process
GO:0007275	0.348	multicellular organism development
GO:0051179	0.346	localization
GO:0048519	0.332	negative regulation of biological process
GO:0051716	0.319	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0016604	0.972	nuclear body
GO:0005694	0.861	chromosome
GO:0032991	0.845	protein-containing complex
GO:0005737	0.597	cytoplasm
GO:0098687	0.382	chromosomal region
GO:0016605	0.355	PML body
GO:0000793	0.342	condensed chromosome
GO:0000775	0.321	chromosome, centromeric region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]