StarFunc result for job id P55884

User Input

>input (814 residues)
MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEAAGTEASSEEVGIAEA
GPESEVRTEPAAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQGEAPGEQARDERSDSR
AQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEA
DGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASP
AHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEA
ECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLATFHQRGIALW
GGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHC
ESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIA
FWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGV
VTNFEIFRMREKQVPVDVVEMKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKI
ELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMASDVEWD
PTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQEQIKQI
KKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRG
GVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55884	1.000	1.000	0.000	814	1.000	1.000	P55884.pdb.gz	EIF3B_HUMAN Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3
2	AFDB:X1WET9	0.690	0.817	0.000	681	0.721	0.862	X1WET9.pdb.gz	X1WET9_DANRE Eukaryotic translation initiation factor 3 subunit B OS=Danio rerio OX=7955 GN=eif3b PE=1 SV=1
3	AFDB:Q0E940	0.688	0.805	2.522E-81	690	0.429	0.506	Q0E940.pdb.gz	EIF3B_DROME Eukaryotic translation initiation factor 3 subunit B OS=Drosophila melanogaster OX=7227 GN=eIF3b PE=1 SV=1
4	PDB:6ybt1	0.624	0.844	6.011E-81	588	0.720	0.997	6ybt1.pdb.gz
5	PDB:7a09B	0.549	0.813	7.897E-74	536	0.657	0.998	7a09B.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
6	AFDB:F4K4D5	0.568	0.624	1.195E-71	738	0.338	0.373	F4K4D5.pdb.gz	F4K4D5_ARATH Eukaryotic translation initiation factor 3 subunit B OS=Arabidopsis thaliana OX=3702 GN=TIF3B1 PE=1 SV=1
7	AFDB:Q9M4T6	0.601	0.677	3.039E-70	716	0.327	0.372	Q9M4T6.pdb.gz	Q9M4T6_ARATH Eukaryotic translation initiation factor 3 subunit B OS=Arabidopsis thaliana OX=3702 PE=1 SV=1
8	PDB:6fyxp	0.536	0.665	1.328E-48	647	0.244	0.308	6fyxp.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
9	PDB:4noxA	0.478	0.835	6.587E-46	460	0.233	0.413	4noxA.pdb.gz
10	PDB:8dysA	0.439	0.839	1.661E-24	409	0.098	0.196	8dysA.pdb.gz
11	PDB:7mq8LR	0.179	0.188	1.654E-14	773	0.064	0.067	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7mq8LO	0.245	0.237	1.535E-13	848	0.057	0.054	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:6lqsB1	0.237	0.239	2.110E-13	806	0.061	0.062	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
14	PDB:7mqaLO	0.247	0.246	2.474E-13	819	0.061	0.061	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:5mzhB	0.288	0.507	4.435E-13	415	0.058	0.113	5mzhB.pdb.gz
16	AFDB:P97499	0.185	0.066	1.325E-12	2629	0.069	0.021	P97499.pdb.gz	TEP1_MOUSE Telomerase protein component 1 OS=Mus musculus OX=10090 GN=Tep1 PE=1 SV=1
17	AFDB:Q32P44	0.174	0.161	2.935E-12	896	0.114	0.104	Q32P44.pdb.gz	EMAL3_HUMAN Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1
18	AFDB:Q04724	0.241	0.252	7.078E-11	770	0.108	0.114	Q04724.pdb.gz	TLE1_HUMAN Transducin-like enhancer protein 1 OS=Homo sapiens OX=9606 GN=TLE1 PE=1 SV=2
19	AFDB:Q64LD2	0.225	0.312	7.078E-11	544	0.090	0.134	Q64LD2.pdb.gz	WDR25_HUMAN WD repeat-containing protein 25 OS=Homo sapiens OX=9606 GN=WDR25 PE=1 SV=3
20	AFDB:H0YL70	0.242	0.250	7.463E-11	782	0.108	0.113	H0YL70.pdb.gz	H0YL70_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P55884	0.0	1684	814	1.000	1.000	EIF3B_HUMAN Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3
2	Q0E940	0.0	700	690	0.431	0.509	EIF3B_DROME Eukaryotic translation initiation factor 3 subunit B OS=Drosophila melanogaster OX=7227 GN=eIF3b PE=1 SV=1
3	Q4G061	0.0	1481	797	0.902	0.921	EIF3B_RAT Eukaryotic translation initiation factor 3 subunit B OS=Rattus norvegicus OX=10116 GN=Eif3b PE=1 SV=1
4	Q8JZQ9	0.0	1494	803	0.910	0.923	EIF3B_MOUSE Eukaryotic translation initiation factor 3 subunit B OS=Mus musculus OX=10090 GN=Eif3b PE=1 SV=1
5	X1WET9	0.0	1237	681	0.721	0.862	X1WET9_DANRE Eukaryotic translation initiation factor 3 subunit B OS=Danio rerio OX=7955 GN=eif3b PE=1 SV=1
6	Q9C5Z1	1.29e-178	532	712	0.342	0.390	EIF3B_ARATH Eukaryotic translation initiation factor 3 subunit B OS=Arabidopsis thaliana OX=3702 GN=TIF3B1 PE=1 SV=1
7	Q8GUM1	1.60e-176	526	714	0.335	0.382	Q8GUM1_ARATH Eukaryotic translation initiation factor 3 subunit B OS=Arabidopsis thaliana OX=3702 GN=EIF3B-2 PE=1 SV=1
8	F4K4D5	2.16e-172	517	738	0.342	0.377	F4K4D5_ARATH Eukaryotic translation initiation factor 3 subunit B OS=Arabidopsis thaliana OX=3702 GN=TIF3B1 PE=1 SV=1
9	Q9M4T6	9.53e-166	499	716	0.328	0.373	Q9M4T6_ARATH Eukaryotic translation initiation factor 3 subunit B OS=Arabidopsis thaliana OX=3702 PE=1 SV=1
10	Q5BGH1	4.22e-162	490	738	0.317	0.350	EIF3B_EMENI Eukaryotic translation initiation factor 3 subunit B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=prt1 PE=3 SV=1
11	G0RXS6	5.37e-152	464	746	0.323	0.353	G0RXS6_CHATD Eukaryotic translation initiation factor 3 subunit B OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=PRT1 PE=1 SV=1
12	Q10425	1.63e-144	444	725	0.319	0.359	EIF3B_SCHPO Eukaryotic translation initiation factor 3 subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC25G10.08 PE=1 SV=1
13	Q5AGV4	1.26e-132	414	739	0.294	0.323	EIF3B_CANAL Eukaryotic translation initiation factor 3 subunit B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PRT1 PE=3 SV=1
14	P06103	2.43e-107	348	763	0.256	0.273	EIF3B_YEAST Eukaryotic translation initiation factor 3 subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRT1 PE=1 SV=1
15	Q57ZT3	1.24e-31	134	696	0.140	0.164	Q57ZT3_TRYB2 Translation initiation factor, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.1010 PE=4 SV=1
16	Q4QE62	9.19e-30	128	709	0.147	0.169	Q4QE62_LEIMA Putative translation initiation factor OS=Leishmania major OX=5664 GN=LMJF_17_1290 PE=4 SV=1
17	O74965	8.70e-27	118	576	0.109	0.155	EIF2A_SCHPO Eukaryotic translation initiation factor 2A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4B4.04 PE=1 SV=1
18	Q9CAT3	1.16e-21	102	513	0.114	0.181	Q9CAT3_ARATH Eukaryotic translation initiation factor 2A OS=Arabidopsis thaliana OX=3702 GN=At1g73180 PE=1 SV=1
19	Q19052	4.61e-21	100	570	0.119	0.170	EIF2A_CAEEL Eukaryotic translation initiation factor 2A OS=Caenorhabditis elegans OX=6239 GN=eif-2A PE=3 SV=2
20	A0A8I6GH40	9.78e-21	99.4	577	0.104	0.147	A0A8I6GH40_RAT Eukaryotic translation initiation factor 2A OS=Rattus norvegicus OX=10116 GN=Eif2a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.21	23.2	Anaphase-promoting complex subunit 4 WD40 domain
2	PF08662 eIF2A	5.2e-69	243.6	Eukaryotic translation initiation factor eIF2A
3	PF16756 PALB2_WD40	5e+02	10.9	Partner and localizer of BRCA2 WD40 domain
4	PF00076 RRM_1	0.00024	32.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354125

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216190	0.999	Eukaryotic translation initiation factor 3 subunit D
2	9606.ENSP00000216554	0.999	Eukaryotic translation initiation factor 5
3	9606.ENSP00000220849	0.999	Eukaryotic translation initiation factor 3 subunit E
4	9606.ENSP00000248342	0.999	Eukaryotic translation initiation factor 3 subunit K
5	9606.ENSP00000253039	0.999	Eukaryotic translation initiation factor 2 subunit 3
6	9606.ENSP00000253108	0.999	Eukaryotic translation initiation factor 3 subunit G
7	9606.ENSP00000256383	0.999	Eukaryotic translation initiation factor 2 subunit 1
8	9606.ENSP00000261868	0.999	Eukaryotic translation initiation factor 3 subunit J
9	9606.ENSP00000332604	0.999	Eukaryotic translation initiation factor 3 subunit C
10	9606.ENSP00000358140	0.999	Eukaryotic translation initiation factor 3 subunit A
11	9606.ENSP00000362688	0.999	Eukaryotic translation initiation factor 3 subunit I
12	9606.ENSP00000429931	0.999	Eukaryotic translation initiation factor 3 subunit H
13	9606.ENSP00000431800	0.999	Eukaryotic translation initiation factor 3 subunit F
14	9606.ENSP00000436049	0.999	Eukaryotic translation initiation factor 3 subunit M
15	9606.ENSP00000485663	0.999	Eukaryotic translation initiation factor 3 subunit L
16	9606.ENSP00000341885	0.998	Ribosomal protein S2
17	9606.ENSP00000364119	0.998	Eukaryotic translation initiation factor 2 subunit 2
18	9606.ENSP00000369757	0.998	40S ribosomal protein S6
19	9606.ENSP00000370258	0.998	Eukaryotic translation initiation factor 3 subunit C-like protein
20	9606.ENSP00000416255	0.998	Eukaryotic translation initiation factor 4 gamma 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003743	0.996	translation initiation factor activity
GO:0003723	0.991	RNA binding
GO:0060090	0.713	molecular adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0010467	0.982	gene expression
GO:0006807	0.972	nitrogen compound metabolic process
GO:0006412	0.945	translation
GO:0006413	0.800	translational initiation
GO:0065007	0.710	biological regulation
GO:0050789	0.704	regulation of biological process
GO:0050794	0.691	regulation of cellular process
GO:0019222	0.475	regulation of metabolic process
GO:0060255	0.438	regulation of macromolecule metabolic process
GO:0051171	0.432	regulation of nitrogen compound metabolic process
GO:0080090	0.430	regulation of primary metabolic process
GO:0031323	0.425	regulation of cellular metabolic process
GO:0051246	0.368	regulation of protein metabolic process
GO:0010468	0.344	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005852	0.997	eukaryotic translation initiation factor 3 complex
GO:0005829	0.994	cytosol
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0043227	0.992	membrane-bounded organelle
GO:0005576	0.985	extracellular region
GO:0070062	0.957	extracellular exosome
GO:0005634	0.901	nucleus
GO:0070013	0.854	intracellular organelle lumen
GO:0031981	0.842	nuclear lumen
GO:0016020	0.841	membrane
GO:0005654	0.819	nucleoplasm
GO:0099080	0.716	supramolecular complex
GO:0035770	0.703	ribonucleoprotein granule
GO:0036464	0.691	cytoplasmic ribonucleoprotein granule
GO:0010494	0.401	cytoplasmic stress granule
GO:0030054	0.391	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]